KEGG   Escherichia coli K-12 MG1655: b2525Help
Entry
b2525             CDS       T00007                                 

Gene name
fdx
Definition
(RefSeq) [2Fe-2S] ferredoxin
  KO
K04755  ferredoxin, 2Fe-2S
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2 Fer2_4
Motif
Other DBs
NCBI-GeneID: 947160
NCBI-ProteinID: NP_417020
Pasteur: fdx
RegulonDB: ECK120001299
ECOCYC: EG11328
ASAP: ABE-0008311
UniProt: P0A9R4
Structure
PDB: 

Jmol
Position
complement(2656748..2657083)
Genome map
AA seq 111 aa AA seqDB search
MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFD
SLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAREH
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagattgttattttgcctcatcaggatctctgccctgatggcgctgttctggaa
gctaatagcggtgaaaccattctcgacgcagctctgcgtaacggtatcgagattgaacac
gcctgtgaaaaatcctgtgcttgcaccacctgccactgcatcgttcgtgaaggttttgac
tcactgccggaaagctcagagcaggaagacgacatgctggacaaagcctggggactggag
ccggaaagccgtttaagctgccaggcgcgcgttaccgacgaagatttagtagtcgaaatc
ccgcgttacactatcaaccatgcgcgtgagcattaa

DBGET integrated database retrieval system