KEGG   Escherichia coli K-12 MG1655: b2525Help
Entry
b2525             CDS       T00007                                 

Gene name
fdx
Definition
(RefSeq) [2Fe-2S] ferredoxin
  KO
K04755  
ferredoxin, 2Fe-2S
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2656748..2657083)
Genome map
AA seq 111 aa AA seqDB search
MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFD
SLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAREH
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagattgttattttgcctcatcaggatctctgccctgatggcgctgttctggaa
gctaatagcggtgaaaccattctcgacgcagctctgcgtaacggtatcgagattgaacac
gcctgtgaaaaatcctgtgcttgcaccacctgccactgcatcgttcgtgaaggttttgac
tcactgccggaaagctcagagcaggaagacgacatgctggacaaagcctggggactggag
ccggaaagccgtttaagctgccaggcgcgcgttaccgacgaagatttagtagtcgaaatc
ccgcgttacactatcaaccatgcgcgtgagcattaa

DBGET integrated database retrieval system