KEGG   Escherichia coli K-12 MG1655: b2529Help
Entry
b2529             CDS       T00007                                 

Gene name
iscU
Definition
(RefSeq) iron-sulfur cluster assembly scaffold protein
  KO
K04488  
nitrogen fixation protein NifU and related proteins
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2659903..2660289)
Genome map
AA seq 128 aa AA seqDB search
MAYSEKVIDHYENPRNVGSFDNNDENVGSGMVGAPACGDVMKLQIKVNDEGIIEDARFKT
YGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIAD
YKSKREAK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcttacagcgaaaaagttatcgaccattacgagaatccgcgtaacgtgggttccttt
gacaacaacgacgagaacgtcggcagcggcatggtgggggcaccggcctgtggcgacgtg
atgaagttgcagattaaagtcaacgatgaaggtatcattgaagacgcgcgttttaaaact
tacggctgcggttccgctatcgcttccagctccctggtcaccgaatgggtgaaagggaag
tctctcgacgaagcgcaggcgatcaaaaacaccgatattgctgaagaacttgaactgccg
ccggtgaaaattcactgttctattctggcagaagacgcgatcaaagccgccattgcggac
tataaaagcaaacgtgaagcaaaataa

DBGET integrated database retrieval system