KEGG   Escherichia coli K-12 MG1655: b2533Help
Entry
b2533             CDS       T00007                                 

Gene name
suhB
Definition
(RefSeq) inositol monophosphatase
  KO
K01092  
myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Streptomycin biosynthesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    b2533 (suhB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    b2533 (suhB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     b2533 (suhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
2663442..2664245
Genome map
AA seq 267 aa AA seqDB search
MHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYP
QHTIITEESGELEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPM
RNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNECA
DFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLTG
NIVAGNPRVVKAMLANMRDELSDALKR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgatgctgaacatcgccgtgcgcgcagcgcgcaaggcgggtaatttaattgcc
aaaaactatgaaaccccggacgctgtagaagcgagccagaaaggcagtaacgatttcgtg
accaacgtagataaagctgccgaagcggtgattatcgacacgattcgtaaatcttaccca
cagcacaccatcatcaccgaagaaagcggtgaacttgaaggtactgatcaggatgttcaa
tgggttatcgatccactggatggcactaccaactttatcaaacgtctgccgcacttcgcg
gtatctatcgctgttcgtatcaaaggccgcaccgaagttgctgtggtatacgatcctatg
cgtaacgaactgttcaccgccactcgcggtcagggcgcacagctgaacggctaccgactg
cgcggcagcaccgctcgcgatctcgacggtactattctggcgaccggcttcccgttcaaa
gcaaaacagtacgccactacctacatcaacatcgtcggcaaactgttcaacgaatgtgca
gacttccgtcgtaccggttctgcggcgctggatctggcttacgtcgctgcgggtcgtgtt
gacggtttctttgaaatcggtctgcgcccgtgggacttcgccgcaggcgagctgctggtt
cgtgaagcgggcggcatcgtcagcgacttcaccggtggtcataactacatgctgaccggt
aacatcgttgctggtaacccgcgcgttgttaaagccatgctggcgaacatgcgtgacgag
ttaagcgacgctctgaagcgttaa

DBGET integrated database retrieval system