KEGG   Escherichia coli K-12 MG1655: b2534Help
Entry
b2534             CDS       T00007                                 

Gene name
yfhR
Definition
(RefSeq) putative S9 family prolyl oligopeptidase
  KO
K06889  
uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2664390..2665244
Genome map
AA seq 284 aa AA seqDB search
MALPVNKRVPKILFILFVVAFCVYLVPRVAINFFYYPDDKIYGPDPWSAESVEFTAKDGT
RLQGWFIPSSTGPADNAIATIIHAHGNAGNMSAHWPLVSWLPERNFNVFMFDYRGFGKSK
GTPSQAGLLDDTQSAINVVRHRSDVNPQRLVLFGQSIGGANILDVIGRGDREGIRAVILD
STFASYATIANQMIPGSGYLLDESYSGENYIASVSPIPLLLIHGKADHVIPWQHSEKLYS
LAKEPKRLILIPDGEHIDAFSDRHGDVYREQMVDFILSALNPQN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccagtgaacaaacgcgttcccaaaattctgtttattctctttgttgttgcc
ttctgcgtttatttagtgccgcgcgttgccatcaacttcttctattatcccgacgataaa
atttacggtcccgatccctggtcggcggaatccgtcgaatttacggctaaggacggtact
cgtctgcaaggctggtttatcccttcttcgacgggccctgctgacaacgccatcgcaacc
atcattcatgctcacggcaatgccggaaatatgtccgcccactggccgctggtcagttgg
ttacccgagcgtaatttcaacgtttttatgtttgattatcgcgggtttggtaaatcaaaa
ggcacgccgtcccaggccggattgctggacgatacgcaaagtgccatcaatgtggtgcgc
catcgcagtgatgtaaacccacaacgtctggtgctgttcgggcagagtattggcggggcg
aatattctggatgttattggtcggggtgatcgtgaaggcatacgtgcggtgatcctcgac
tccacatttgcctcttatgcaaccatcgccaaccaaatgatccccggcagtggctactta
cttgatgagagttacagcggcgaaaattatatcgccagcgtcagcccgatcccgctttta
ctcattcacggtaaagctgatcacgttatcccatggcagcacagcgaaaagttgtatagc
ctggcaaaagagccaaaacggttgatcctaatcccggatggcgaacacattgatgctttt
tccgatcgtcacggcgatgtttatcgcgaacagatggtggactttatccttagcgcgttg
aatccgcagaactaa

DBGET integrated database retrieval system