KEGG   Escherichia coli K-12 MG1655: b2535Help
Entry
b2535             CDS       T00007                                 

Gene name
csiE
Definition
(RefSeq) stationary phase inducible protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2665435..2666715
Genome map
AA seq 426 aa AA seqDB search
MMPTLAPPSVLSAPQRRCQILLTLFQPGLTATMATFSELNGVDDDIASLDISETGREILR
YHQLTLTTGYDGSYRVEGTVLNQRLCLFHWLRRGFRLCPSFITSQFTPALKSELKRRGIA
RNFYDDTNLQALVNLCSRRLQKRFESRDIHFLCLYLQYCLLQHHAGITPQFNPLQRRWAE
SCLEFQVAQEIGRHWQRRALQPVPPDEPLFMALLFSMLRVPDPLRDAHQRDRQLRQSIKR
LVNHFRELGNVRFYDEQGLCDQLYTHLAQALNRSLFAIGIDNTLPEEFARLYPRLVRTTR
AALAGFESEYGVHLSDEESGLVAVIFGAWLMQENDLHEKQIILLTGNDSEREAQIEQQLR
ELTLLPLNIKHMSVKAFLQTGAPRGAALIIAPYTMPLPLFSPPLIYTDLTLTTHQQEQIR
KMLESA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctacgcttgctccaccatctgtcctttcggctccccagcgccgctgccagatc
ttgctgacgctctttcagccggggttgaccgccaccatggcaaccttcagcgagcttaat
ggtgtggatgatgatattgccagtcttgatatcagcgaaacaggacgggagatcctgcgc
tatcatcaactcacactgacgactggttatgacggtagctaccgggttgaaggtacagtg
cttaaccaacgtttgtgtttatttcactggctacgacgtggtttccgtctgtgtccgtca
tttattaccagccaattcacccccgccctgaagagtgaactgaagcggcgcggaattgcg
cgtaacttttacgacgataccaatctacaagcgttagtgaatctctgctcccgacggctg
caaaaacgctttgaatcgcgcgatattcatttcctgtgtctgtatctgcaatattgtttg
ctgcagcaccacgctggaattacgcctcagtttaatccgctccaacgtcgctgggcggaa
tcctgccttgaatttcaggtagcgcaggaaattggacgccactggcagcgtcgggcgctc
cagcctgtaccacctgatgagccactgtttatggcactacttttttccatgttgcgggtt
cccgatccattgcgggatgcgcatcagcgggacagacaattgcgtcagtctatcaaacgt
ctggtaaaccattttcgtgagctgggaaatgttcgtttttatgatgaacaggggttatgt
gatcagctttatacccacctcgcccaggcgttaaatcgcagtttgtttgccatcggtatt
gataataccctgccggaagagttcgccagactgtacccacgcctggtgcgcaccacccgc
gcggcgctggccggatttgaaagtgaatacggcgtccatctttctgatgaggaaagtggt
ctggtcgcggtgattttcggtgcctggctaatgcaggaaaacgatctgcatgaaaaacag
attattcttcttaccgggaatgatagcgagcgagaagcgcagattgagcagcagttacgc
gaactaacgttactgccgctcaacattaagcatatgtcggtaaaggcatttttgcagaca
ggcgctccgcgtggcgcggcactgattattgcgccttataccatgccattaccgctcttt
tcaccaccgctgatctatacggacctgacgctgacaacacatcaacaggagcagatccgc
aaaatgctcgaatcagcatga

DBGET integrated database retrieval system