KEGG   Escherichia coli K-12 MG1655: b2540Help
Entry
b2540             CDS       T00007                                 

Gene name
hcaC
Definition
(RefSeq) 3-phenylpropionate dioxygenase, ferredoxin subunit
  KO
K05710  
3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin component
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Phenylalanine metabolism
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    b2540 (hcaC)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    b2540 (hcaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2670908..2671228
Genome map
AA seq 106 aa AA seqDB search
MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATV
ECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaatttatgcgtgtcccgttgcggatgtgccggagggtgaggctctccggatc
gatacctcgcccgtcatcgccctgttcaacgttggcggcgagttttatgccattaacgat
cgttgcagccatggtaatgcgtcaatgtcagaagggtatctggaagatgacgccacggtg
gagtgcccgctacacgccgccagtttttgcctgaaaacggggaaagcgttatgcctgccc
gccaccgatccgctcaccacttatccagtacacgttgaaggtggtgacattttcatcgac
ttaccggaggcgcagccatga

DBGET integrated database retrieval system