KEGG   Escherichia coli K-12 MG1655: b2543Help
Entry
b2543             CDS       T00007                                 

Gene name
yphA
Definition
(RefSeq) DoxX family inner membrane protein
  KO
K15977  putative oxidoreductase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DoxX SURF4
Motif
Other DBs
NCBI-GeneID: 947365
NCBI-ProteinID: NP_417038
Pasteur: yphA
RegulonDB: ECK120003907
ECOCYC: G7337
ASAP: ABE-0008365
UniProt: P0AD47
Position
2673346..2673768
Genome map
AA seq 140 aa AA seqDB search
MNTLRYFDFGAARPVLLLIARIAVVLIFIIFGFPKMMGFDGTVQYMASLGAPMPMLAAII
AVVMEVPAAILIVLGFFTRPLAVLFIFYTLGTAVIGHHYWDMTGDAVGPNMINFWKNVSI
AGAFLLLAITGPGAISLDRR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaacacactacgttattttgattttggagctgcccgccccgttttgttattaattgcc
cgtatcgccgtggtcttaattttcattatttttggttttcccaaaatgatgggctttgac
ggtacggtccaatatatggcctcgttgggcgcgccaatgccgatgctggcagcgattatt
gcggtagttatggaagtgcccgccgcgatattaatcgtgcttggctttttcacccgtccg
ctggcggtgctgtttattttctacacgctgggtacggcggtgattggtcaccattactgg
gatatgaccggcgatgcggttgggccaaatatgattaatttctggaagaatgtcagtatc
gctggcgcgttcttgctattggcaattaccgggccgggggcaatttctctcgatcggcgt
tag

DBGET integrated database retrieval system