KEGG   Escherichia coli K-12 MG1655: b2548Help
Entry
b2548             CDS       T00007                                 

Gene name
yphF
Definition
(RefSeq) putative ABC superfamily sugar transporter periplasmic-binding protein
  KO
K02058  
simple sugar transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Module
Putative simple sugar transport system
Brite
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    b2548 (yphF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2678384..2679367)
Genome map
AA seq 327 aa AA seqDB search
MPTKMRTTRNLLLMATLLGSALFARAAEKEMTIGAIYLDTQGYYAGVRQGVQDAAKDSSV
QVQLIETNAQGDISKESTFVDTLVARNVDAIILSAVSENGSSRTVRRASEAGIPVICYNT
CINQKGVDKYVSAYLVGDPLEFGKKLGNAAADYFIANKIDQPKIAVINCEAFEVCVQRRK
GFEEVLKSRVPGAQIVANQEGTVLDKAISVGEKLIISTPDLNAIMGESGGATLGAVKAVR
NQNQAGKIAVFGSDMTTEIAQELENNQVLKAVVDISGKKMGNAVFAQTLKVINKQADGEK
VIQVPIDLYTKTEDGKQWLATHVDGLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaaaaatgagaacaacccgtaatctattattaatggctacgctattaggtagc
gcactatttgccagggctgcggaaaaagaaatgaccattggcgcaatataccttgatact
cagggatactacgctggagtgcgtcagggcgttcaggatgcggcaaaagattcctcagta
caagttcagttaatagaaactaacgcccagggtgatatttcgaaagaaagtacctttgtt
gataccctcgtggcgcgtaatgtcgatgccattattttatcggcagtgtctgaaaatggc
agtagccgtaccgttcgtcgcgccagtgaagcgggcattccggtgatttgctacaacacc
tgtattaatcaaaagggggtcgataaatatgtctcggcgtatctggtcggcgatccgctg
gaatttggtaaaaaactgggtaacgctgccgctgattattttattgccaataaaattgac
cagccgaaaattgccgtcatcaattgcgaagcctttgaagtttgtgtgcagcgacgtaaa
ggatttgaagaagttttaaaatcccgcgttcccggcgcgcaaattgtcgctaatcaggaa
gggactgttttagataaagcgatttccgttggtgaaaaactaattatctccacgccggat
ctcaacgccattatgggggaatcgggcggtgcgacactcggcgcggtaaaagcggtacgt
aatcaaaatcaggccggaaaaattgctgttttcggttcggatatgacaaccgaaattgct
caggagctggaaaacaatcaggtgctgaaagcggtagtggatatttccggtaagaaaatg
ggcaatgctgttttcgcgcaaacattgaaggttatcaataaacaagccgacggtgaaaaa
gtgattcaggtgcctatcgatctctataccaaaacggaagacggtaaacagtggctggca
acgcacgttgatggtctgccctaa

DBGET integrated database retrieval system