KEGG   Escherichia coli K-12 MG1655: b2563Help
Entry
b2563             CDS       T00007                                 

Gene name
acpS
Definition
(RefSeq) holo-[acyl-carrier-protein] synthase 1
  KO
K00997  holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b2563 (acpS)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     b2563 (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS Tecti-min-caps YdaS_antitoxin
Motif
Other DBs
NCBI-GeneID: 947037
NCBI-ProteinID: NP_417058
Pasteur: acpS
RegulonDB: ECK120000241
ECOCYC: EG10247
ASAP: ABE-0008433
UniProt: P24224
Structure
PDB: 

Jmol
Position
complement(2700618..2700998)
Genome map
AA seq 126 aa AA seqDB search
MAILGLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIWKTHHQPVRFLAKRFAVKEAA
AKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVANMHVTLADERHYACA
TVIIES
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcaatattaggtttaggcacggatattgtggagatcgctcgcatcgaagcggtgatc
gcccgatccggtgatcgcctggcacgccgcgtattaagcgataacgaatgggctatctgg
aaaacgcaccaccagccggtgcgttttctggcgaagcgttttgctgtgaaagaagccgca
gcaaaagcgtttggcaccgggatccgcaatggtctggcgtttaatcaatttgaagtattc
aatgatgagctcggcaaaccacggctacggctatggggcgaggcattaaaactggcggaa
aagctgggcgttgcaaatatgcatgtaacgctggcagatgagcggcactatgcttgtgcc
acggtaattattgaaagttaa

DBGET integrated database retrieval system