KEGG   Escherichia coli K-12 MG1655: b2564Help
Entry
b2564             CDS       T00007                                 

Gene name
pdxJ
Definition
(RefSeq) pyridoxine 5'-phosphate synthase
  KO
K03474  pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00750  Vitamin B6 metabolism
eco01100  Metabolic pathways
Module
eco_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    b2564 (pdxJ)
Enzymes [BR:eco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.99  Transferring other nitrogenous groups
    2.6.99.2  pyridoxine 5'-phosphate synthase
     b2564 (pdxJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxJ AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 947039
NCBI-ProteinID: NP_417059
Pasteur: pdxJ
RegulonDB: ECK120000685
ECOCYC: EG10693
ASAP: ABE-0008435
UniProt: P0A794
Structure
PDB: 

Jmol
Position
complement(2700998..2701729)
Genome map
AA seq 243 aa AA seqDB search
MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRI
LRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC
KRLADAGIQVSLFIDADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQELARIAKAAT
FAASLGLKVNAGHGLTYHNVKAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKRLMLE
ARG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattactgttaggcgtcaacattgaccatatcgctacgctgcgcaacgcgcgc
ggtaccgcttacccggatccggtgcaggccgcgtttattgccgagcaggcgggagcggac
ggcattaccgtgcatttacgtgaagatcgccgtcacattactgaccgcgacgtgcgcatc
ctgcgtcagacgctggatacccgcatgaatctggagatggcggtgaccgaagagatgctg
gcgatcgccgttgagacgaagccacatttttgctgcctggtaccggaaaagcgtcaggaa
gtaacaaccgaaggcggcctggatgtcgcagggcagcgtgacaaaatgcgcgatgcctgc
aaacgtctggcagatgccgggattcaggtttctctgtttattgacgccgatgaagagcag
atcaaagctgcggcagaggttggcgcaccgtttatcgagatccacaccggttgctatgct
gatgccaaaactgacgccgaacaggcgcaagagctggcgcgtatcgccaaagccgcgacc
tttgccgcaagcctcggtctgaaagttaacgccggacacggtctgacctatcacaacgtg
aaagccattgccgccatccctgagatgcatgaactgaatatcggtcatgccattattggt
cgtgcagtgatgaccggactgaaagatgcggtggcagaaatgaagcgtctgatgctggaa
gcgcgtggctaa

DBGET integrated database retrieval system