KEGG   Escherichia coli K-12 MG1655: b2567Help
Entry
b2567             CDS       T00007                                 

Gene name
rnc
Definition
(RefSeq) RNase III (EC:3.1.26.3)
  KO
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     b2567 (rnc)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     b2567 (rnc)
Ribosome biogenesis [BR:eco03009]
 Eukaryotic Type
  90S particles
   RNase
    b2567 (rnc)
 Prokaryotic Type
  rRNA processing factors
   b2567 (rnc)
Chromosome [BR:eco03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     b2567 (rnc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2703383..2704063)
Genome map
AA seq 226 aa AA seqDB search
MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSYVIANALYHRF
PRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGFRRESILADTVEALI
GGVFLDSDIQTVEKLILNWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPTYLVVQVR
GEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKKLELE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccatcgtaattaatcggcttcaacggaagctgggctacacttttaatcatcag
gaactgttgcagcaggcattaactcatcgtagtgccagcagtaaacataacgagcgttta
gaatttttaggcgactctattctgagctacgttatcgccaatgcgctttatcaccgtttc
cctcgtgtggatgaaggcgatatgagccggatgcgcgccacgctggtccgtggcaatacg
ctggcggaactggcgcgcgaatttgagttaggcgagtgcttacgtttagggccaggtgaa
cttaaaagcggtggatttcgtcgtgagtcaattctcgccgacaccgtcgaagcattaatt
ggtggcgtattcctcgacagtgatattcaaaccgtcgagaaattaatcctcaactggtat
caaactcgtttggacgaaattagcccaggcgataaacaaaaagatccgaaaacgcgcttg
caagaatatttgcagggtcgccatctgccgctgccgacttatctggtagtccaggtacgt
ggcgaagcgcacgatcaggaatttactatccactgccaggtcagcggcctgagtgaaccg
gtggttggcacaggttcaagccgtcgtaaggctgagcaggctgccgccgaacaggcgttg
aaaaaactggagctggaatga

DBGET integrated database retrieval system