KEGG   Escherichia coli K-12 MG1655: b2578Help
Entry
b2578             CDS       T00007                                 

Gene name
eamB
Definition
(RefSeq) cysteine and O-acetylserine exporter
  KO
K11249  
cysteine/O-acetylserine efflux protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2578 (eamB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2715423..2716010
Genome map
AA seq 195 aa AA seqDB search
MTPTLLSAFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGI
SFSLAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKI
ILYGVTALSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNI
VLALLLVYCAVRIFY
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgacaccgacccttttaagtgctttttggacttacaccctgattaccgctatgacgcca
ggaccgaacaatattctcgcccttagctctgctacgtcgcatggatttcgtcaaagtacc
cgcgtgctggcagggatgagtctgggatttttgattgtgatgttactgtgtgcgggcatt
tcattttcactggcagtgattgacccggcagcggtacaccttttgagttgggcgggggcg
gcatatattgtctggctggcgtggaaaatcgccaccagcccaacaaaggaagacggactt
caggcaaaaccaatcagcttttgggccagctttgctttgcagtttgtgaacgtcaaaatc
attttgtacggtgttacggcactgtcgacgtttgttctgccgcaaacacaggcgttaagc
tgggtagttggcgtcagcgttttgctggcgatgattgggacgtttggcaatgtgtgctgg
gcgctggcggggcatctgtttcagcgattgtttcgccagtatggtcgccagttaaatatc
gtgcttgccctgttgctggtctattgcgcggtacgcattttctattaa

DBGET integrated database retrieval system