KEGG   Escherichia coli K-12 MG1655: b2587Help
Entry
b2587             CDS       T00007                                 

Gene name
kgtP
Definition
(RefSeq) alpha-ketoglutarate transporter
  KO
K03761  
MFS transporter, MHS family, alpha-ketoglutarate permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    b2587 (kgtP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2724448..2725746)
Genome map
AA seq 432 aa AA seqDB search
MAESTVTADSKLTSSDTRRRIWAIVGASSGNLVEWFDFYVYSFCSLYFAHIFFPSGNTTT
QLLQTAGVFAAGFLMRPIGGWLFGRIADKHGRKKSMLLSVCMMCFGSLVIACLPGYETIG
TWAPALLLLARLFQGLSVGGEYGTSATYMSEVAVEGRKGFYASFQYVTLIGGQLLALLVV
VVLQHTMEDAALREWGWRIPFALGAVLAVVALWLRRQLDETSQQETRALKEAGSLKGLWR
NRRAFIMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANVASGIMTAALFVFMLIQPLIG
ALSDKIGRRTSMLCFGSLAAIFTVPILSALQNVSSPYAAFGLVMCALLIVSFYTSISGIL
KAEMFPAQVRALGVGLSYAVANAIFGGSAEYVALSLKSIGMETAFFWYVTLMAVVAFLVS
LMLHRKGKGMRL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagtactgtaacggcagacagcaaactgacaagtagtgatactcgtcgccgc
atttgggcgattgtgggggcctcttcaggtaatctggtcgagtggttcgatttctatgtc
tactcgttctgttcactctactttgcccacatcttcttcccttccgggaacacgacgact
caactactacaaacagcaggtgtttttgctgcgggattcctgatgcgcccaataggcggt
tggctatttggccgcatagccgataaacatggtcgcaaaaaatcgatgctgttatcggtg
tgtatgatgtgtttcggatcgctggttatcgcctgcctcccaggttatgaaactataggt
acgtgggctccggcattattgcttctcgctcgtttatttcagggattatctgttggcgga
gaatatggcaccagcgccacctatatgagtgaagttgccgttgaagggcgcaaaggtttt
tacgcatcatttcagtatgtgacgttgatcggcggacaactgctagccctactggttgtc
gtggttttacaacacaccatggaagacgctgcactcagagagtggggatggcgtattcct
ttcgcgttaggagctgtgttagctgttgtggcgttgtggttacgtcgtcagttagatgaa
acttcgcaacaagaaacgcgcgctttaaaagaagctggatctctgaaaggattatggcgc
aatcgccgtgcattcatcatggttctcggttttaccgctgcgggctccctttgtttctat
accttcactacttatatgcagaagtatctggtaaatactgcgggaatgcatgccaacgtg
gcgagtggcattatgactgccgcattgtttgtattcatgcttattcaaccactcattggc
gcgctgtcggataagattggtcgccgtacctcaatgttatgtttcggttcgctggcagcc
atttttaccgttcctattctctcagcattgcaaaacgtttcctcgccttatgccgctttt
ggtctggtgatgtgtgccctgctgatagtgagtttttatacatcaatcagtggaatactg
aaggctgagatgttcccggcacaggttcgcgcattaggcgttggtctgtcatatgcggtc
gctaatgctatatttggtggttcggcggagtacgtagcgttgtcgctgaaatcaatagga
atggaaacagccttcttctggtatgtgaccttgatggccgtggtggcgtttctggtttct
ttgatgctacatcgcaaagggaaggggatgcgtctttag

DBGET integrated database retrieval system