KEGG   Escherichia coli K-12 MG1655: b2592Help
Entry
b2592             CDS       T00007                                 

Gene name
clpB
Definition
(RefSeq) protein disaggregation chaperone
  KO
K03695  
ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
eco  Escherichia coli K-12 MG1655
Brite
Chaperones and folding catalysts [BR:eco03110]
 Heat shock proteins
  HSP100
   b2592 (clpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2731600..2734173)
Genome map
AA seq 857 aa AA seqDB search
MRLDRLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVSPLLTSAGINAGQL
RTDINQALNRLPQVEGTGGDVQPSQDLVRVLNLCDKLAQKRGDNFISSELFVLAALESRG
TLADILKAAGATTANITQAIEQMRGGESVNDQGAEDQRQALKKYTIDLTERAEQGKLDPV
IGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLAL
DMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMDAGNMLK
PALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIAILRGLKERYELH
HHVQITDPAIVAAATLSHRYIADRQLPDKAIDLIDEAASSIRMQIDSKPEELDRLDRRII
QLKLEQQALMKESDEASKKRLDMLNEELSDKERQYSELEEEWKAEKASLSGTQTIKAELE
QAKIAIEQARRVGDLARMSELQYGKIPELEKQLEAATQLEGKTMRLLRNKVTDAEIAEVL
ARWTGIPVSRMMESEREKLLRMEQELHHRVIGQNEAVDAVSNAIRRSRAGLADPNRPIGS
FLFLGPTGVGKTELCKALANFMFDSDEAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGG
YLTEAVRRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNL
GSDLIQERFGELDYAHMKELVLGVVSHNFRPEFINRIDEVVVFHPLGEQHIASIAQIQLK
RLYKRLEERGYEIHISDEALKLLSENGYDPVYGARPLKRAIQQQIENPLAQQILSGELVP
GKVIRLEVNEDRIVAVQ
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctggatcgtcttactaataaattccagcttgctcttgccgatgcccaatcactt
gcactcgggcacgacaaccaatttatcgaaccacttcatttaatgagcgccctgctgaat
caggaagggggttcggttagtcctttattaacatccgctggcataaatgctggccagttg
cgcacagatatcaatcaggcattaaatcgtttaccgcaggttgaaggtactggtggtgat
gtccagccatcacaggatctggtgcgcgttcttaatctttgcgacaagctggcgcaaaaa
cgtggtgataactttatctcgtcagaactgttcgttctggcggcacttgagtctcgcggc
acgctggccgacatcctgaaagcagcaggggcgaccaccgccaacattactcaagcgatt
gaacaaatgcgtggaggtgaaagcgtgaacgatcaaggtgctgaagaccaacgtcaggct
ttgaaaaaatataccatcgaccttaccgaacgagccgaacagggcaaactcgatccggtg
attggtcgtgatgaagaaattcgccgtaccattcaggtgctgcaacgtcgtactaaaaat
aacccggtactgattggtgaacccggcgtcggtaaaactgccatcgttgaaggtctggcg
cagcgtattatcaacggcgaagtgccggaagggttgaaaggccgccgggtactggcgctg
gatatgggcgcgctggtggctggggcgaaatatcgcggtgagtttgaagaacgtttaaaa
ggcgtgcttaacgatcttgccaaacaggaaggcaacgtcatcctatttatcgacgaatta
cataccatggtcggcgcgggtaaagccgatggcgcaatggacgccggaaacatgctgaaa
ccggcgctggcgcgtggtgaattgcactgcgtaggtgccacgacgcttgacgaatatcgc
cagtacattgaaaaagatgctgcgctggaacgtcgtttccagaaagtgtttgttgccgag
ccttctgttgaagataccattgcgattctgcgtggcctgaaagaacgttacgaattgcac
caccatgtgcaaattactgacccggcaattgttgcagcggcgacgttgtctcatcgctac
attgctgaccgtcagctgccggataaagccatcgacctgatcgatgaagcagcatccagc
attcgtatgcagattgactcaaaaccagaagaactcgaccgactcgatcgtcgtatcatc
cagctcaaactggaacaacaggcgttaatgaaagagtctgatgaagccagtaaaaaacgt
ctggatatgctcaacgaagaactgagcgacaaagaacgtcagtactccgagttagaagaa
gagtggaaagcagagaaggcatcgctttctggtacgcagaccattaaagcggaactggaa
caggcgaaaatcgctattgaacaggctcgccgtgtgggggacctggcgcggatgtctgaa
ctgcaatacggcaaaatcccggaactggaaaagcaactggaagccgcaacgcagctcgaa
ggcaaaactatgcgtctgttgcgtaataaagtgaccgacgccgaaattgctgaagtgctg
gcgcgttggacggggattccggtttctcgcatgatggaaagcgagcgcgaaaaactgctg
cgtatggagcaagaactgcaccatcgcgtaattggtcagaacgaagcggttgatgcggta
tctaacgctattcgtcgtagccgtgcggggctggcggatccaaatcgcccgattggttca
ttcctgttcctcggcccaactggtgtggggaaaacagagctttgtaaggcgctggcgaac
tttatgtttgatagcgacgaggcgatggtccgtatcgatatgtccgagtttatggagaaa
cactcggtgtctcgtttggttggtgcgcctccgggatatgtcggttatgaagaaggtggc
tacctgaccgaagcggtgcgtcgtcgtccgtattccgtcatcctgctggatgaagtggaa
aaagcgcatccggatgtcttcaacattctgttgcaggtactggatgatgggcgtctgact
gacgggcaagggagaacggtcgacttccgtaatacggtcgtcattatgacctctaacctc
ggttccgatctgattcaggaacgcttcggtgaactggattatgcgcacatgaaagagctg
gtgctcggtgtggtaagccataacttccgtccggaattcattaaccgtatcgatgaagtg
gtggtcttccatccgctgggtgaacagcacattgcctcgattgcgcagattcagttgaaa
cgtctgtacaaacgtctggaagaacgtggttatgaaatccacatttctgacgaggcgctg
aaactgctgagcgagaacggttacgatccggtctatggtgcacgtcctctgaaacgtgca
attcagcagcagatcgaaaacccgctggcacagcaaatactgtctggtgaattggttccg
ggtaaagtgattcgcctggaagttaatgaagaccggattgtcgccgtccagtaa

DBGET integrated database retrieval system