KEGG   Escherichia coli K-12 MG1655: b2597Help
Entry
b2597             CDS       T00007                                 

Gene name
raiA
Definition
(RefSeq) cold shock protein associated with 30S ribosomal subunit
  KO
K05809  
ribosome-associated inhibitor A
Organism
eco  Escherichia coli K-12 MG1655
Brite
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  Other maturation factors
   b2597 (raiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
2737154..2737495
Genome map
AA seq 113 aa AA seqDB search
MTMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVADATINTPNGV
LVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAATSVKDANFVEEVEEE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaacattaccagcaaacaaatggaaattactccggccatccgccaacatgtc
gcagaccgtctcgccaaactggaaaaatggcaaacacatctgattaatccacatatcatt
ctgtccaaagagccacaagggtttgttgctgacgccacaatcaatacacctaacggcgtt
ctggttgccagtggtaaacatgaagatatgtacaccgcaattaacgaattgatcaacaag
ctggaacggcagctcaataaactgcagcacaaaggcgaagcacgtcgtgccgcaacatcg
gtgaaagacgccaacttcgtcgaagaagttgaagaagagtag

DBGET integrated database retrieval system