KEGG   Escherichia coli K-12 MG1655: b2597Help
Entry
b2597             CDS       T00007                                 

Gene name
raiA
Definition
(RefSeq) cold shock protein associated with 30S ribosomal subunit
  KO
K05809  ribosome-associated inhibitor A
Organism
eco  Escherichia coli K-12 MG1655
Brite
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  Other maturation factors
   b2597 (raiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S30AE DUF1690
Motif
Other DBs
NCBI-GeneID: 947129
NCBI-ProteinID: NP_417088
Pasteur: yfiA
RegulonDB: ECK120001134
ECOCYC: EG11151
ASAP: ABE-0008540
UniProt: P0AD49
Structure
PDB: 

Jmol
Position
2737154..2737495
Genome map
AA seq 113 aa AA seqDB search
MTMNITSKQMEITPAIRQHVADRLAKLEKWQTHLINPHIILSKEPQGFVADATINTPNGV
LVASGKHEDMYTAINELINKLERQLNKLQHKGEARRAATSVKDANFVEEVEEE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaacattaccagcaaacaaatggaaattactccggccatccgccaacatgtc
gcagaccgtctcgccaaactggaaaaatggcaaacacatctgattaatccacatatcatt
ctgtccaaagagccacaagggtttgttgctgacgccacaatcaatacacctaacggcgtt
ctggttgccagtggtaaacatgaagatatgtacaccgcaattaacgaattgatcaacaag
ctggaacggcagctcaataaactgcagcacaaaggcgaagcacgtcgtgccgcaacatcg
gtgaaagacgccaacttcgtcgaagaagttgaagaagagtag

DBGET integrated database retrieval system