KEGG   Escherichia coli K-12 MG1655: b2601Help
Entry
b2601             CDS       T00007                                 

Gene name
aroF
Definition
(RefSeq) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase, tyrosine-repressible
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
eco01230  Biosynthesis of amino acids
eco02024  Quorum sensing
Module
eco_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    b2601 (aroF)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b2601 (aroF)
Enzymes [BR:eco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     b2601 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-GeneID: 947084
NCBI-ProteinID: NP_417092
Pasteur: aroF
RegulonDB: ECK120000074
ECOCYC: EG10078
ASAP: ABE-0008549
UniProt: P00888
Position
complement(2740080..2741150)
Genome map
AA seq 356 aa AA seqDB search
MQKDALNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCG
PCSIHDPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDV
EAGLQIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGL
SMPVGFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKAP
NYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGL
MIESNIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQLTARVA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacgcgctgaataacgtacatattaccgacgaacaggttttaatgactccg
gaacaactgaaggccgcttttccattgagcctgcaacaagaagcccagattgctgactcg
cgtaaaagcatttcagatattatcgccgggcgcgatcctcgtctgctggtagtatgtggt
ccttgttccattcatgatccggaaactgctctggaatatgctcgtcgatttaaagccctt
gccgcagaggtcagcgatagcctctatctggtaatgcgcgtctattttgaaaaaccccgt
accactgtcggctggaaagggttaattaacgatccccatatggatggctcttttgatgta
gaagccgggctgcagatcgcgcgtaaattgctgcttgagctggtgaatatgggactgcca
ctggcgacggaagcgttagatccgaatagcccgcaatacctgggcgatctgtttagctgg
tcagcaattggtgctcgtacaacggaatcgcaaactcaccgtgaaatggcctccgggctt
tccatgccggttggttttaaaaacggcaccgacggcagtctggcaacagcaattaacgct
atgcgcgccgccgcccagccgcaccgttttgttggcattaaccaggcagggcaggttgcg
ttgctacaaactcaggggaatccggacggccatgtgatcctgcgcggtggtaaagcgccg
aactatagccctgcggatgttgcgcaatgtgaaaaagagatggaacaggcgggactgcgc
ccgtctctgatggtagattgcagccacggtaattccaataaagattatcgccgtcagcct
gcggtggcagaatccgtggttgctcaaatcaaagatggcaatcgctcaattattggtctg
atgatcgaaagtaatatccacgagggcaatcagtcttccgagcaaccgcgcagtgaaatg
aaatacggtgtatccgtaaccgatgcctgcattagctgggaaatgaccgatgccttgctg
cgtgaaattcatcaggatctgaacgggcagctgacggctcgcgtggcttaa

DBGET integrated database retrieval system