KEGG   Escherichia coli K-12 MG1655: b2610Help
Entry
b2610             CDS       T00007                                 

Gene name
ffh
Definition
(RefSeq) Signal Recognition Particle (SRP) component with 4.5S RNA (ffs)
  KO
K03106  
signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    b2610 (ffh)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    b2610 (ffh)
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    b2610 (ffh)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     b2610 (ffh)
Secretion system [BR:eco02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   b2610 (ffh)
  Eukaryotic Sec-SRP protein
   b2610 (ffh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2746434..2747795)
Genome map
AA seq 453 aa AA seqDB search
MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAV
GHEVNKSLTPGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKL
GKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAK
LKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEAL
PLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDV
LSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQI
PDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQF
DDMQRMMKKMKKGGMAKMMRSMKGMMPPGFPGR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataatttaaccgatcgtttgtcgcgcacgctgcgcaatatcagtggccgtgga
cgcctcactgaagacaacgtaaaagatacgctgcgcgaagtgcgcatggcgctgctggag
gcggacgtagctctgccggtagtgcgtgagtttatcaatcgcgtaaaagagaaagcggtt
ggtcatgaagttaataagagcctgacgccggggcaggagttcgtcaaaatagtccgtaac
gaactggttgcggcgatgggcgaagagaaccagaccctgaacctggctgcgcaaccgcct
gcggtcgtactgatggcgggcctgcaaggtgccggtaaaacaaccagcgttggtaaactc
ggtaagttcctgcgcgagaagcacaagaagaaagtgctggtggtttctgccgacgtttat
cgcccggcggcaatcaaacagcttgagacgctggcagagcaggtgggcgttgatttcttc
ccttctgatgttggtcagaagccggtagatatcgttaacgcggcgctgaaagaagccaaa
ctgaaattctacgacgtgctgctggtggataccgctggtcgtctgcacgttgacgaagcg
atgatggacgagatcaaacaagtccatgcgtcgattaacccggttgaaaccctgtttgtg
gttgacgccatgaccggtcaggatgcggccaatacggcaaaagcattcaatgaagcgtta
ccgcttaccggcgtagtgttgaccaaagtggacggcgatgcccgcggcggtgcggcgctc
tctattcgtcacatcactggcaaaccgatcaagttcctcggtgttggcgagaaaactgag
gcgctggagccgttccatccggaccgcatcgcgtcgcgtattctcggcatgggcgacgta
ctgtcgctgatcgaagatatcgaaagcaaagttgaccgcgcgcaggcagagaaattagcc
agcaagctgaaaaaaggtgacggcttcgatctcaacgactttcttgagcagctgcgccag
atgaaaaatatgggcggcatggctagtctgatgggcaagctgccgggcatggggcagatc
ccggataacgtcaagtcacagatggacgataaagtgctggtgcgtatggaagccatcatc
aactcgatgacgatgaaagagcgcgctaagccagaaatcatcaaaggttcgcgtaaacgc
cgtattgctgccggttgcggtatgcaggtgcaggacgttaaccgtcttctgaaacagttc
gacgacatgcagcgcatgatgaagaaaatgaagaagggcggaatggcgaagatgatgaga
agcatgaagggtatgatgcccccaggcttccctggtcgctaa

DBGET integrated database retrieval system