KEGG   Escherichia coli K-12 MG1655: b2610Help
Entry
b2610             CDS       T00007                                 

Gene name
ffh
Definition
(RefSeq) Signal Recognition Particle (SRP) component with 4.5S RNA (ffs)
  KO
K03106  
signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    b2610 (ffh)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    b2610 (ffh)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     b2610 (ffh)
Secretion system [BR:eco02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   b2610 (ffh)
  Eukaryotic Sec-SRP protein
   b2610 (ffh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2746434..2747795)
Genome map
AA seq 453 aa AA seqDB search
MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAV
GHEVNKSLTPGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKL
GKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAK
LKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEAL
PLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDV
LSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQI
PDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQF
DDMQRMMKKMKKGGMAKMMRSMKGMMPPGFPGR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataatttaaccgatcgtttgtcgcgcacgctgcgcaatatcagtggccgtgga
cgcctcactgaagacaacgtaaaagatacgctgcgcgaagtgcgcatggcgctgctggag
gcggacgtagctctgccggtagtgcgtgagtttatcaatcgcgtaaaagagaaagcggtt
ggtcatgaagttaataagagcctgacgccggggcaggagttcgtcaaaatagtccgtaac
gaactggttgcggcgatgggcgaagagaaccagaccctgaacctggctgcgcaaccgcct
gcggtcgtactgatggcgggcctgcaaggtgccggtaaaacaaccagcgttggtaaactc
ggtaagttcctgcgcgagaagcacaagaagaaagtgctggtggtttctgccgacgtttat
cgcccggcggcaatcaaacagcttgagacgctggcagagcaggtgggcgttgatttcttc
ccttctgatgttggtcagaagccggtagatatcgttaacgcggcgctgaaagaagccaaa
ctgaaattctacgacgtgctgctggtggataccgctggtcgtctgcacgttgacgaagcg
atgatggacgagatcaaacaagtccatgcgtcgattaacccggttgaaaccctgtttgtg
gttgacgccatgaccggtcaggatgcggccaatacggcaaaagcattcaatgaagcgtta
ccgcttaccggcgtagtgttgaccaaagtggacggcgatgcccgcggcggtgcggcgctc
tctattcgtcacatcactggcaaaccgatcaagttcctcggtgttggcgagaaaactgag
gcgctggagccgttccatccggaccgcatcgcgtcgcgtattctcggcatgggcgacgta
ctgtcgctgatcgaagatatcgaaagcaaagttgaccgcgcgcaggcagagaaattagcc
agcaagctgaaaaaaggtgacggcttcgatctcaacgactttcttgagcagctgcgccag
atgaaaaatatgggcggcatggctagtctgatgggcaagctgccgggcatggggcagatc
ccggataacgtcaagtcacagatggacgataaagtgctggtgcgtatggaagccatcatc
aactcgatgacgatgaaagagcgcgctaagccagaaatcatcaaaggttcgcgtaaacgc
cgtattgctgccggttgcggtatgcaggtgcaggacgttaaccgtcttctgaaacagttc
gacgacatgcagcgcatgatgaagaaaatgaagaagggcggaatggcgaagatgatgaga
agcatgaagggtatgatgcccccaggcttccctggtcgctaa

DBGET integrated database retrieval system