KEGG   Escherichia coli K-12 MG1655: b2642Help
Entry
b2642             CDS       T00007                                 

Gene name
yfjW
Definition
(RefSeq) CP4-57 prophage; putative inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2773318..2775021
Genome map
AA seq 567 aa AA seqDB search
MAFVSEREIVRKIFSKKIDFTILAFFYISSIFFLLCSGVLFQYFTAAFTKGNCYECSMKL
DYIKQFYFSLETAWYLISAVAVFIASVFIQHRIKAYLTLLAITWIVLTITDVALIHALDN
IAMNNILLNILYNLFGAILLSLFMCLSNSLLFHLNKIKHIPMILSAMIPLVSAIIIAILI
TAVIYLLFARQAVEIEMDISEGSDIAYVGVKDNEESFGFLNDKKTDTPTYLDVIKNGSLI
YNDTQGLSGADIYIVSGCYALPDLLRNVPLDAKKSFLNVKKLEITQKLPMMGFIQGESAD
VMPKAASRLSLSKQDDKFMLASSVTDSQIKFKSNNAQLMVAFAFMPITTNGILHDYTYDI
IINDKKYKIENHVAPLSRLDKNKKMKCEYQQISDLTNTYNINANYLTGFLLVLKPDDIIN
YNNSPSVLLKTDFAFYKKTYQKLDKIYDDISNGKLSSLRATGISQFSINGKHLSLRPESE
IIISEGSLYGLVNKSKKIKIYGTADLVFVDNKIMNLRKITYLQSKLEIFGSSIMDILKYI
FGLGLLAISIKFIHSYFKNDVNENLFL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtatcagaaagagaaattgtaagaaagatatttagcaaaaaaattgacttt
acgatcttggcatttttctatatttcctctattttttttcttctttgtagtggcgttctc
tttcaatattttaccgctgccttcacaaaaggtaattgttatgaatgctcaatgaaactt
gattacataaaacaattttatttttcactggaaaccgcatggtacctcatatctgctgtt
gcagtatttattgcatctgtttttatacagcatagaattaaagcttatttaacattatta
gctattacatggattgtactaacaataacagatgtggcgttaatacacgccttagacaat
atagccatgaataatattttgttaaatatactatataatctttttggggcgattttattg
tcactgtttatgtgtttatcaaattccctccttttccaccttaataagataaaacatatt
ccaatgattttatcggcaatgattccattagtttccgcaataataatagccatactcata
accgctgttatatatttattgtttgcccggcaggcggtagagattgagatggatatatct
gaaggttcagacatcgcatatgtaggtgtaaaagataatgaggaatcatttgggttttta
aatgataaaaaaacagacacaccaacgtatctggatgtaatcaaaaatggtagtttgata
tataatgatacacagggtttaagtggtgctgatatttatattgtctccggttgttatgcc
cttccagatttacttcgcaatgtaccgcttgatgctaaaaaatcttttctgaatgtaaaa
aagctagaaatcacacagaaacttccaatgatggggttcatacaaggtgaatccgctgat
gtgatgcctaaagcagcatccaggttaagtttgagcaagcaagatgataaatttatgcta
gcctcaagtgttactgactctcaaataaaatttaaatcaaacaatgcacaattgatggtt
gctttcgcatttatgccaataacaacgaatggtattttacatgattatacatacgatata
ataataaatgataaaaaatataaaattgaaaatcatgttgcacctctatctaggcttgat
aaaaataagaagatgaagtgtgaataccagcaaatatcggatttaacaaatacgtataac
attaatgcaaattacttaacgggttttttacttgtcctaaaaccagatgatattattaat
tacaacaatagcccttccgtactactcaagactgattttgcgttctataaaaaaacatac
cagaagcttgataaaatatatgatgacataagcaatggaaaattatcttcactgagagca
acaggtatctcccagtttagtatcaacgggaaacatttgtcgttaaggccagaatcggag
attattatttctgaagggagtttgtatggactagttaataaaagcaaaaaaatcaaaata
tatggcacagcagatcttgtttttgttgataacaagataatgaaccttcgtaaaataact
tatttgcaatctaagctagaaatttttggttcttctattatggatatattaaagtatata
tttggtttaggtctgctagcaatttctataaaattcattcattcttactttaagaatgat
gtgaatgaaaatttattcttgtaa

DBGET integrated database retrieval system