KEGG   Escherichia coli K-12 MG1655: b2662Help
Entry
b2662             CDS       T00007                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate aminotransferase, PLP-dependent (EC:2.6.1.19)
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    b2662 (gabT)
   00650 Butanoate metabolism
    b2662 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b2662 (gabT)
   00280 Valine, leucine and isoleucine degradation
    b2662 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    b2662 (gabT)
Enzymes [BR:eco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     b2662 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     b2662 (gabT)
Amino acid related enzymes [BR:eco01007]
 Aminotransferase (transaminase)
  Class III
   b2662 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
2792735..2794015
Genome map
AA seq 426 aa AA seqDB search
MNSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FDEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggtggccgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgcctcgtcgccagcc
tttatgcagcgtttacgcgctctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatcttaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtaatggatgccgtcgctccaggcggtctgggcggcacctatgcgggt
aacccgattgcctgcgtggctgcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagttgaaagacggattgctggcgatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccattgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgatgaggcgaagcagtag

DBGET integrated database retrieval system