KEGG   Escherichia coli K-12 MG1655: b2663Help
Entry
b2663             CDS       T00007                                 

Gene name
gabP
Definition
(RefSeq) gamma-aminobutyrate transporter
  KO
K11735  
GABA permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2663 (gabP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2794253..2795653
Genome map
AA seq 466 aa AA seqDB search
MGQSSQPHELGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWVLVIPLEANIAAMILHSW
VPGIPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIFLGAVAISGFYPY
AEVSGISRLWDSGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPEKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKAVGSYRSVLELLNIPHAKLIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAVMGKINRSKTPYVAVLLSTGAAFLTVVVNYYAPAKVF
KFLIDSSGAIALLVYLVIAVSQLRMRKILRAEGSEIRLRMWLYPWLTWLVIGFITFVLVV
MLFRPAQQLEVISTGLLAIGIICTVPIMARWKKLVLWQKTPVHNTR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaatcatcgcaaccacatgagttaggcggcgggctgaagtcacgccacgtcacc
atgttgtctattgccggtgttatcggcgcaagtctgtttgtcggttccagcgtcgccatc
gccgaagcgggcccggcggtattactggcctatctgttcgccgggctactggtggttatg
attatgcggatgttggcggaaatggcggttgccacgcccgataccggttcgttttccacc
tatgccgataaagccattggtcgctgggcgggctataccatcggctggttgtactggtgg
ttttgggtactggttatcccgctggaagccaacatcgccgccatgatcctgcactcatgg
gttccaggcattcccatctggttattttccctcgtcattaccctcgccttaactggcagt
aacttattaagcgttaaaaactacggcgaatttgagttctggctggcgctgtgcaaagtc
atcgctatcctggcctttattttccttggtgcagtcgcaattagcggtttttacccgtat
gccgaagtgagcgggatctcaagattgtgggatagcggcggctttatgcccaacggtttc
ggtgcggtattaagcgcgatgttgatcaccatgttctcgtttatgggcgcagaaattgtc
accattgccgccgcggaatccgacacgccggaaaaacatattgtccgcgccaccaactcg
gttatctggcgtatttctatcttctatttatgttctatttttgtcgtcgtggcattaatt
ccgtggaatatgcccggactaaaagccgtcggttcttatcgctcggtactggaattgctc
aatattccccatgcgaaattaatcatggactgcgtgatattactttccgtaaccagttgc
ctgaactcggcgctgtataccgcgtcaaggatgctctactccttaagtcgtcgcggtgat
gctcccgcggtaatgggtaaaatcaaccgcagtaaaaccccgtacgtggcggtgttactc
tccaccggcgcggcattcttaacggtggtggtgaactattacgcgcctgcgaaggtattt
aaatttctgatcgacagctccggcgctatcgccctgctggtttatttagtcatcgccgtt
tcacagttgcggatgcgcaaaattctgcgagcagaaggaagcgaaattcgcttgcgaatg
tggctttatccgtggctcacctggctagtcatcggctttattacctttgtgttggtagtg
atgctattccgtccggcgcaacagttagaagtgatctccaccggcttattagcgataggg
attatctgtaccgtgccaattatggctcgctggaaaaagctggtattgtggcaaaaaaca
cccgttcataatacgcgctga

DBGET integrated database retrieval system