KEGG   Escherichia coli K-12 MG1655: b2666Help
Entry
b2666             CDS       T00007                                 

Gene name
yqaE
Definition
(RefSeq) cyaR sRNA-regulated protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2796870..2797028)
Genome map
AA seq 52 aa AA seqDB search
MGFWRIVITIILPPLGVLLGKGFGWAFIINILLTLLGYIPGLIHAFWVQTRD
NT seq 159 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctggagaatcgtcatcaccatcattctgccgccgctcggcgtgctgctcggt
aaagggttcggttgggcgttcattattaatattctgttgacactgcttgggtatatcccc
ggtttgattcacgcgttctgggtgcaaacccgcgattaa

DBGET integrated database retrieval system