KEGG   Escherichia coli K-12 MG1655: b2674Help
Entry
b2674             CDS       T00007                                 

Gene name
nrdI
Definition
(RefSeq) NrdEF cluster assembly flavodoxin
  KO
K03647  
protein involved in ribonucleotide reduction
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
2800965..2801375
Genome map
AA seq 136 aa AA seqDB search
MSQLVYFSSSSENTQRFIERLGLPAVRIPLNERERIQVDEPYILIVPSYGGGGTAGAVPR
QVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIEN
VRKGVTEFWQRQPQNA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctcgtctacttctccagcagctccgaaaacacgcagcgttttatcgaacgt
ttaggtctgcccgcggtgcgcatcccgctcaatgagcgggaacggattcaggtagacgag
ccttacatcctgatcgtgccctcttacggcggcggcggtacggctggcgcggtgccacga
caggtaattcgctttttaaacgacgagcacaaccgggcgttgcttcgcggcgttattgct
tctggtaatcgcaactttggtgaggcgtatggccgcgccggagatgtgattgcccggaaa
tgcggcgtgccgtggctgtaccgttttgaactcatgggtacgcaaagcgatatcgaaaac
gttcgtaaaggagtaaccgaattttggcaacgacaaccgcagaatgcctga

DBGET integrated database retrieval system