KEGG   Escherichia coli K-12 MG1655: b2674Help
Entry
b2674             CDS       T00007                                 

Gene name
nrdI
Definition
(RefSeq) NrdEF cluster assembly flavodoxin
  KO
K03647  protein involved in ribonucleotide reduction
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_NdrI
Motif
Other DBs
NCBI-GeneID: 947158
NCBI-ProteinID: NP_417160
Pasteur: nrdI
RegulonDB: ECK120003969
ECOCYC: G7402
ASAP: ABE-0008804
UniProt: P0A772
Structure
PDB: 

Jmol
Position
2800965..2801375
Genome map
AA seq 136 aa AA seqDB search
MSQLVYFSSSSENTQRFIERLGLPAVRIPLNERERIQVDEPYILIVPSYGGGGTAGAVPR
QVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIEN
VRKGVTEFWQRQPQNA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctcgtctacttctccagcagctccgaaaacacgcagcgttttatcgaacgt
ttaggtctgcccgcggtgcgcatcccgctcaatgagcgggaacggattcaggtagacgag
ccttacatcctgatcgtgccctcttacggcggcggcggtacggctggcgcggtgccacga
caggtaattcgctttttaaacgacgagcacaaccgggcgttgcttcgcggcgttattgct
tctggtaatcgcaactttggtgaggcgtatggccgcgccggagatgtgattgcccggaaa
tgcggcgtgccgtggctgtaccgttttgaactcatgggtacgcaaagcgatatcgaaaac
gttcgtaaaggagtaaccgaattttggcaacgacaaccgcagaatgcctga

DBGET integrated database retrieval system