KEGG   Escherichia coli K-12 MG1655: b2677Help
Entry
b2677             CDS       T00007                                 

Gene name
proV
Definition
(RefSeq) glycine betaine transporter subunit
  KO
K02000  
glycine betaine/proline transport system ATP-binding protein [EC:3.6.3.32]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2677 (proV)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.32  quaternary-amine-transporting ATPase
     b2677 (proV)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    b2677 (proV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2804815..2806017
Genome map
AA seq 400 aa AA seqDB search
MAIKLEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIM
GLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPH
MTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALA
INPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN
GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRTPNGLIRKTPGFGPRSAL
KLLQDEDREYGYVIERGNKFVGAVSIDSLKTALTQQQGLDAALIDAPLAVDAQTPLSELL
SHVGQAPCAVPVVDEDQQYVGIISKGMLLRALDREGVNNG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaattagaaattaaaaatctttataaaatatttggcgagcatccacagcga
gcgttcaaatatatcgaacaaggactttcaaaagaacaaattctggaaaaaactgggcta
tcgcttggcgtaaaagacgccagtctggccattgaagaaggcgagatatttgtcatcatg
ggattatccggctcgggtaaatccacaatggtacgccttctcaatcgcctgattgaaccc
acccgcgggcaagtgctgattgatggtgtggatattgccaaaatatccgacgccgaactc
cgtgaggtgcgcagaaaaaagattgcgatggtcttccagtcctttgccttaatgccgcat
atgaccgtgctggacaatactgcgttcggtatggaattggccggaattaatgccgaagaa
cgccgggaaaaagcccttgatgcactgcgtcaggtcgggctggaaaattatgcccacagc
tacccggatgaactctctggcgggatgcgtcaacgtgtgggattagcccgcgcgttagcg
attaatccggatatattattaatggacgaagccttctcggcgctcgatccattaattcgc
accgagatgcaggatgagctggtaaaattacaggcgaaacatcagcgcaccattgtcttt
atttcccacgatcttgatgaagccatgcgtattggcgaccgaattgccattatgcaaaat
ggtgaagtggtacaggtcggcacaccggatgaaattctcaataatccggcgaatgattat
gtccgtaccttcttccgtggcgttgatattagtcaggtattcagtgcgaaagatattgcc
cgccggacaccgaatggcttaattcgtaaaacccctggcttcggcccacgttcggcactg
aaattattgcaggatgaagatcgcgaatatggctacgttatcgaacgcggtaataagttt
gtcggcgcagtctccatcgattcgcttaaaaccgcgttaacgcagcagcaaggtcttgat
gcggcgctgattgatgcgccgttagcagtcgatgcacaaacgcctcttagcgagttgctc
tctcatgtcggacaggcaccctgtgcggtgcccgtggtcgacgaggaccaacagtatgtc
ggcatcatttcgaaaggaatgctgctgcgcgctttagatcgtgagggggtaaataatggc
tga

DBGET integrated database retrieval system