KEGG   Escherichia coli K-12 MG1655: b2677Help
Entry
b2677             CDS       T00007                                 

Gene name
proV
Definition
(RefSeq) glycine betaine/proline ABC transporter periplasmic binding protein
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:3.6.3.32]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00208  Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2677 (proV)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.32  quaternary-amine-transporting ATPase
     b2677 (proV)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    b2677 (proV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran CBS AAA_16 AAA_21 ABC_ATPase AAA_29 AAA_30 AAA_22 SMC_N AAA RsgA_GTPase AAA_18 DUF2802 BCA_ABC_TP_C AAA_33 APS_kinase DUF87 SbcCD_C
Motif
Other DBs
NCBI-GeneID: 947148
NCBI-ProteinID: NP_417163
Pasteur: proV
RegulonDB: ECK120000762
ECOCYC: EG10771
ASAP: ABE-0008814
UniProt: P14175
Position
2804815..2806017
Genome map
AA seq 400 aa AA seqDB search
MAIKLEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIM
GLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPH
MTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALA
INPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN
GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRTPNGLIRKTPGFGPRSAL
KLLQDEDREYGYVIERGNKFVGAVSIDSLKTALTQQQGLDAALIDAPLAVDAQTPLSELL
SHVGQAPCAVPVVDEDQQYVGIISKGMLLRALDREGVNNG
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaattagaaattaaaaatctttataaaatatttggcgagcatccacagcga
gcgttcaaatatatcgaacaaggactttcaaaagaacaaattctggaaaaaactgggcta
tcgcttggcgtaaaagacgccagtctggccattgaagaaggcgagatatttgtcatcatg
ggattatccggctcgggtaaatccacaatggtacgccttctcaatcgcctgattgaaccc
acccgcgggcaagtgctgattgatggtgtggatattgccaaaatatccgacgccgaactc
cgtgaggtgcgcagaaaaaagattgcgatggtcttccagtcctttgccttaatgccgcat
atgaccgtgctggacaatactgcgttcggtatggaattggccggaattaatgccgaagaa
cgccgggaaaaagcccttgatgcactgcgtcaggtcgggctggaaaattatgcccacagc
tacccggatgaactctctggcgggatgcgtcaacgtgtgggattagcccgcgcgttagcg
attaatccggatatattattaatggacgaagccttctcggcgctcgatccattaattcgc
accgagatgcaggatgagctggtaaaattacaggcgaaacatcagcgcaccattgtcttt
atttcccacgatcttgatgaagccatgcgtattggcgaccgaattgccattatgcaaaat
ggtgaagtggtacaggtcggcacaccggatgaaattctcaataatccggcgaatgattat
gtccgtaccttcttccgtggcgttgatattagtcaggtattcagtgcgaaagatattgcc
cgccggacaccgaatggcttaattcgtaaaacccctggcttcggcccacgttcggcactg
aaattattgcaggatgaagatcgcgaatatggctacgttatcgaacgcggtaataagttt
gtcggcgcagtctccatcgattcgcttaaaaccgcgttaacgcagcagcaaggtcttgat
gcggcgctgattgatgcgccgttagcagtcgatgcacaaacgcctcttagcgagttgctc
tctcatgtcggacaggcaccctgtgcggtgcccgtggtcgacgaggaccaacagtatgtc
ggcatcatttcgaaaggaatgctgctgcgcgctttagatcgtgagggggtaaataatggc
tga

DBGET integrated database retrieval system