KEGG   Escherichia coli K-12 MG1655: b2679Help
Entry
b2679             CDS       T00007                                 

Gene name
proX
Definition
(RefSeq) glycine betaine transporter subunit
  KO
K02002  
glycine betaine/proline transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b2679 (proX)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    b2679 (proX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
2807132..2808124
Genome map
AA seq 330 aa AA seqDB search
MRHSVLFATAFATLISTQTFAADLPGKGITVNPVQSTITEETFQTLLVSRALEKLGYTVN
KPSEVDYNVGYTSLASGDATFTAVNWTPLHDNMYEAAGGDKKFYREGVFVNGAAQGYLID
KKTADQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTV
THNQGNYAAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGKDVVWLQVPFSALPGDKNA
DTKLPNGANYGFPVSTMHIVANKAWAEKNPAAAKLFAIMQLPVADINAQNAIMHDGKASE
GDIQGHVDGWIKAHQQQFDGWVNEALAAQK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatagcgtactttttgcgacagcgtttgccacgcttatctctacacaaactttt
gctgccgatctgccgggcaaaggcattactgttaatccagttcagagcaccatcactgaa
gaaaccttccagacgctgctggtcagtcgtgcgctggagaaattaggttataccgtcaac
aaacccagcgaagtagattacaacgttggctacacctcgcttgcttccggcgatgcaacc
ttcaccgccgtgaactggacgccactgcatgacaacatgtacgaagctgccggtggcgat
aagaaattttatcgtgaaggggtatttgttaacggcgcggcacagggttacctgatcgat
aagaaaaccgccgaccagtacaaaatcaccaacatcgcacaactgaaagatccgaagatc
gccaaactgttcgataccaacggcgacggaaaagcggatttaaccggttgtaaccctggc
tggggctgcgaaggtgcgatcaaccaccagcttgccgcgtatgaactgaccaacaccgtg
acgcataatcaggggaactacgcagcgatgatggccgacaccatcagtcgctacaaagag
ggcaaaccggtgttttattacacctggacgccgtactgggtgagtaacgaactgaagccg
ggcaaagatgtcgtctggttgcaggtgccgttctccgcactgccgggcgataaaaacgcc
gataccaaactgccgaatggtgcgaattatggcttcccggtcagcaccatgcatatcgtt
gccaacaaagcctgggccgagaaaaacccggcagcagcgaaactgtttgccattatgcag
ttgccagtggcagatattaacgcccagaacgccattatgcatgacggcaaagcctcagaa
ggcgatattcagggacacgttgatggttggatcaaagcccaccagcagcagttcgatggc
tgggtgaatgaggcgctggcagcgcagaagtaa

DBGET integrated database retrieval system