KEGG   Escherichia coli K-12 MG1655: b2685Help
Entry
b2685             CDS       T00007                                 

Gene name
emrA
Definition
(RefSeq) multidrug efflux system
  KO
K03543  
membrane fusion protein, multidrug efflux system
Organism
eco  Escherichia coli K-12 MG1655
Module
Multidrug resistance, efflux pump EmrAB
Brite
Transporters [BR:eco02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   b2685 (emrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2811427..2812599
Genome map
AA seq 390 aa AA seqDB search
MSANAETQTPQQPVKKSGKRKRLLLLLTLLFIIIAVAIGIYWFLVLRHFEETDDAYVAGN
QIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMI
NSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQ
YNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPT
TPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAF
SLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSVNTTNRDGQVLANKVR
STPVAVSTAREISLAPVNKLIDDIVKANAG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaatgcggagactcaaaccccgcagcaaccggtaaagaagagcggcaaacgt
aagcgtctgctcctccttctcaccttgctctttataattattgccgtagcgatagggatt
tattggtttttggtactgcgtcacttcgaagaaaccgatgacgcatacgtggcagggaat
caaattcaaattatgtctcaggtgtctggcagcgtgacgaaagtctgggccgataacacc
gattttgtaaaagaaggcgacgtgctggtcactctcgacccgacagatgctcgccaggcg
tttgaaaaagccaaaactgcactggcttccagcgttcgccaaacccaccagctgatgatt
aacagcaagcagttgcaggcgaatattgaggtgcagaaaatcgccctcgcgaaagcacaa
agcgactacaaccgccgtgtgccgctgggcaatgccaacctgattggtcgcgaagagctg
caacacgcccgcgacgccgtcaccagtgcccaggcgcaactggacgtcgcgattcaacaa
tacaatgccaatcaggcgatgattctggggactaaactggaagatcagccagccgtgcaa
caggctgccaccgaagtacgtaacgcctggctggcgctggagcgtactcgtattatcagt
ccgatgaccggttatgtctcccgccgcgcggtacagcctggggcgcaaattagcccaacg
acgccgctgatggcggtcgttccagccaccaatatgtgggtggatgccaactttaaagag
acgcagattgccaatatgcgtatcggtcagccggtcactatcaccacggatatttacggc
gatgatgtgaaatacaccggtaaagtggttggtctggatatgggcacaggtagcgcgttc
tcactgcttccagcgcaaaatgcgaccggtaactggatcaaagtcgttcagcgtctgcct
gtgcgtatcgaactggaccagaaacagctggagcaatatccgctgcgtatcggtttgtcc
acgctggtgagcgtcaataccactaaccgtgacggtcaggtactggcaaataaagtacgt
tccactccggtagcggtaagcaccgcgcgtgaaatcagcctggcacctgtcaataaactg
atcgacgatatcgtaaaagctaacgctggctaa

DBGET integrated database retrieval system