KEGG   Escherichia coli K-12 MG1655: b2699Help
Entry
b2699             CDS       T00007                                 

Gene name
recA
Definition
(RefSeq) DNA recombination and repair protein; ssDNA-dependent ATPase; synaptase; ssDNA and dsDNA binding protein forming filaments; ATP-dependent homologous DNA strand exchanger; recombinase A; LexA autocleavage cofactor
  KO
K03553  
recombination protein RecA
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    b2699 (recA)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     b2699 (recA)
    RecFOR pathway proteins
     b2699 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    b2699 (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2822708..2823769)
Genome map
AA seq 353 aa AA seqDB search
MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG
RIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQP
DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVG
SETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIG
QGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTPDFSVDDSEGVAETNEDF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgacgaaaacaaacagaaagcgttggcggcagcactgggccagattgagaaa
caatttggtaaaggctccatcatgcgcctgggtgaagaccgttccatggatgtggaaacc
atctctaccggttcgctttcactggatatcgcgcttggggcaggtggtctgccgatgggc
cgtatcgtcgaaatctacggaccggaatcttccggtaaaaccacgctgacgctgcaggtg
atcgccgcagcgcagcgtgaaggtaaaacctgtgcgtttatcgatgctgaacacgcgctg
gacccaatctacgcacgtaaactgggcgtcgatatcgacaacctgctgtgctcccagccg
gacaccggcgagcaggcactggaaatctgtgacgccctggcgcgttctggcgcagtagac
gttatcgtcgttgactccgtggcggcactgacgccgaaagcggaaatcgaaggcgaaatc
ggcgactctcacatgggccttgcggcacgtatgatgagccaggcgatgcgtaagctggcg
ggtaacctgaagcagtccaacacgctgctgatcttcatcaaccagatccgtatgaaaatt
ggtgtgatgttcggtaacccggaaaccactaccggtggtaacgcgctgaaattctacgcc
tctgttcgtctcgacatccgtcgtatcggcgcggtgaaagagggcgaaaacgtggtgggt
agcgaaacccgcgtgaaagtggtgaagaacaaaatcgctgcgccgtttaaacaggctgaa
ttccagatcctctacggcgaaggtatcaacttctacggcgaactggttgacctgggcgta
aaagagaagctgatcgagaaagcaggcgcgtggtacagctacaaaggtgagaagatcggt
cagggtaaagcgaatgcgactgcctggctgaaagataacccggaaaccgcgaaagagatc
gagaagaaagtacgtgagttgctgctgagcaacccgaactcaacgccggatttctctgta
gatgatagcgaaggcgtagcagaaactaacgaagatttttaa

DBGET integrated database retrieval system