KEGG   Escherichia coli K-12 MG1655: b2713Help
Entry
b2713             CDS       T00007                                 

Gene name
hydN
Definition
(RefSeq) formate dehydrogenase-H, [4Fe-4S] ferredoxin subunit
  KO
K05796  
electron transport protein HydN
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2837578..2838105)
Genome map
AA seq 175 aa AA seqDB search
MNRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIHVIKGVNISTATVCRQ
CEDAPCANVCPNGAISRDKGFVHVMQERCIGCKTCVVACPYGAMEVVVRPVIRNSGAGLN
VRADKAEANKCDLCNHREDGPACMAACPTHALICVDRNKLEQLSAEKRRRTALMF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtttcatcattgctgacgcgagtaaatgtattggttgccgtacctgtgaagta
gcgtgcgtggtttctcatcaggaaaatcaggactgtgcatcgctgaccccggaaactttt
ttaccgcgtatccatgtcattaaaggtgtgaacatttccacggcgacagtttgccgtcag
tgtgaagatgcaccgtgcgctaacgtctgcccgaatggtgctatcagccgtgataaaggg
tttgttcatgtgatgcaggaacgttgcattggttgcaaaacctgcgttgtggcttgcccg
tatggtgcgatggaagtggtggtacgtccggtgatccgcaacagcggcgcgggtctgaat
gtacgggctgacaaagccgaagccaataaatgcgacctgtgcaaccatcgtgaagacggc
ccggcgtgtatggcggcttgcccgactcatgcgctgatttgtgtcgatcgtaataaactt
gaacaactgagcgcagaaaaacgccgccgtacggcgctgatgttctaa

DBGET integrated database retrieval system