KEGG   Escherichia coli K-12 MG1655: b2779Help
Entry
b2779             CDS       T00007                                 

Gene name
eno
Definition
(RefSeq) enolase (EC:4.2.1.11)
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
RNA degradosome
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b2779 (eno)
   01230 Biosynthesis of amino acids
    b2779 (eno)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b2779 (eno)
  Energy metabolism
   00680 Methane metabolism
    b2779 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b2779 (eno)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     b2779 (eno)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     b2779 (eno)
Exosome [BR:eco04147]
 Exosomal proteins
  Proteins found in most exosomes
   b2779 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2906643..2907941)
Genome map
AA seq 432 aa AA seqDB search
MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAK
AAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVK
EAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA
PYNGRKEIKGQA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcgtaaaaatcatcggtcgtgaaatcatcgactcccgtggtaacccgact
gttgaagccgaagtacatctggagggtggtttcgtcggtatggcagctgctccgtcaggt
gcttctactggttcccgtgaagctctggaactgcgcgatggcgacaaatcccgtttcctg
ggtaaaggcgtaaccaaagctgttgctgcggtaaacggcccgatcgctcaggcgctgatt
ggcaaagatgctaaagatcaggctggcattgacaagatcatgatcgacctggacggcacc
gaaaacaaatccaaattcggcgcgaacgcaatcctggctgtatctctggctaacgccaaa
gctgctgcagctgctaaaggtatgccgctgtacgagcacatcgctgaactgaacggtact
ccgggcaaatactctatgccggttccgatgatgaacatcatcaacggtggtgagcacgct
gacaacaacgttgatatccaggaattcatgattcagccggttggcgcgaaaactgtgaaa
gaagccatccgcatgggttctgaagttttccatcacctggcaaaagttctgaaagcgaaa
ggcatgaacactgctgttggtgacgaaggtggctatgcgccgaacctgggttccaacgct
gaagctctggctgttatcgctgaagctgttaaagctgctggttatgaactgggcaaagac
atcactttggcgatggactgcgcagcttctgaattctacaaagatggtaaatacgttctg
gctggcgaaggcaacaaagcgttcacctctgaagaattcactcacttcctggaagaactg
accaaacagtacccgatcgtttctatcgaagacggtctggacgaatctgactgggacggt
ttcgcataccagaccaaagttctgggcgacaaaatccagctggttggtgacgacctgttc
gtaaccaacaccaagatcctgaaagaaggtatcgaaaaaggtatcgctaactccatcctg
atcaaattcaaccagatcggttctctgaccgaaactctggctgcaatcaagatggcgaaa
gatgctggctacactgcagttatctctcaccgttctggcgaaactgaagacgctaccatc
gctgacctggctgttggtactgctgcaggccagatcaaaactggttctatgagccgttct
gaccgtgttgctaaatacaaccagctgattcgtatcgaagaagctctgggcgaaaaagca
ccgtacaacggtcgtaaagagatcaaaggccaggcataa

DBGET integrated database retrieval system