KEGG   Escherichia coli K-12 MG1655: b2779Help
Entry
b2779             CDS       T00007                                 

Gene name
eno
Definition
(RefSeq) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00680  Methane metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
eco01230  Biosynthesis of amino acids
eco03018  RNA degradation
Module
eco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eco_M00002  Glycolysis, core module involving three-carbon compounds
eco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
eco_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b2779 (eno)
  Energy metabolism
   00680 Methane metabolism
    b2779 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b2779 (eno)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     b2779 (eno)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     b2779 (eno)
Exosome [BR:eco04147]
 Exosomal proteins
  Proteins found in most exosomes
   b2779 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-GeneID: 945032
NCBI-ProteinID: NP_417259
Pasteur: eno
RegulonDB: ECK120000252
ECOCYC: EG10258
ASAP: ABE-0009110
UniProt: P0A6P9
Structure
PDB: 

Jmol
Position
complement(2906643..2907941)
Genome map
AA seq 432 aa AA seqDB search
MSKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFL
GKGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTENKSKFGANAILAVSLANAK
AAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVK
EAIRMGSEVFHHLAKVLKAKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKD
ITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDG
FAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAK
DAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKA
PYNGRKEIKGQA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcgtaaaaatcatcggtcgtgaaatcatcgactcccgtggtaacccgact
gttgaagccgaagtacatctggagggtggtttcgtcggtatggcagctgctccgtcaggt
gcttctactggttcccgtgaagctctggaactgcgcgatggcgacaaatcccgtttcctg
ggtaaaggcgtaaccaaagctgttgctgcggtaaacggcccgatcgctcaggcgctgatt
ggcaaagatgctaaagatcaggctggcattgacaagatcatgatcgacctggacggcacc
gaaaacaaatccaaattcggcgcgaacgcaatcctggctgtatctctggctaacgccaaa
gctgctgcagctgctaaaggtatgccgctgtacgagcacatcgctgaactgaacggtact
ccgggcaaatactctatgccggttccgatgatgaacatcatcaacggtggtgagcacgct
gacaacaacgttgatatccaggaattcatgattcagccggttggcgcgaaaactgtgaaa
gaagccatccgcatgggttctgaagttttccatcacctggcaaaagttctgaaagcgaaa
ggcatgaacactgctgttggtgacgaaggtggctatgcgccgaacctgggttccaacgct
gaagctctggctgttatcgctgaagctgttaaagctgctggttatgaactgggcaaagac
atcactttggcgatggactgcgcagcttctgaattctacaaagatggtaaatacgttctg
gctggcgaaggcaacaaagcgttcacctctgaagaattcactcacttcctggaagaactg
accaaacagtacccgatcgtttctatcgaagacggtctggacgaatctgactgggacggt
ttcgcataccagaccaaagttctgggcgacaaaatccagctggttggtgacgacctgttc
gtaaccaacaccaagatcctgaaagaaggtatcgaaaaaggtatcgctaactccatcctg
atcaaattcaaccagatcggttctctgaccgaaactctggctgcaatcaagatggcgaaa
gatgctggctacactgcagttatctctcaccgttctggcgaaactgaagacgctaccatc
gctgacctggctgttggtactgctgcaggccagatcaaaactggttctatgagccgttct
gaccgtgttgctaaatacaaccagctgattcgtatcgaagaagctctgggcgaaaaagca
ccgtacaacggtcgtaaagagatcaaaggccaggcataa

DBGET integrated database retrieval system