KEGG   Escherichia coli K-12 MG1655: b2780Help
Entry
b2780             CDS       T00007                                 

Gene name
pyrG
Definition
(RefSeq) CTP synthetase (EC:6.3.4.2)
  KO
K01937  
CTP synthase [EC:6.3.4.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    b2780 (pyrG)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     b2780 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2908029..2909666)
Genome map
AA seq 545 aa AA seqDB search
MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEV
FVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHIT
NAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVEIGREHTLFMHLTLVPYM
AASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKD
VDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIFEEANPVSEVTIGMVGKYIE
LPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGVEILKGLDAILVPGGFGYRGVEG
MITTARFARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVALITEWR
DENGNVEVRSEKSDLGGTMRLGAQQCQLVDDSLVRQLYNAPTIVERHRHRYEVNNMLLKQ
IEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASEFQ
KRQAK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaactatatttttgtgaccggcggggtcgtatcctctctgggtaaaggcatt
gccgcagcctccctcgcagccattcttgaagcccgtggcctcaatgtgaccatcatgaaa
ctggatccgtacatcaacgtcgatccaggtactatgagcccaatccaacacggggaagtg
ttcgttactgaagacggcgctgaaaccgacctggacctggggcactacgagcgtttcatt
cgtaccaaaatgagccgccgcaacaacttcaccacgggtcgtatctactctgacgttctg
cgtaaagaacgccgcggtgactacctcggcgcaaccgtgcaggttattccgcacatcact
aacgcaatcaaagagcgcgtgctggaaggtggcgaaggtcatgacgtagtactggtagaa
atcggcggtacagtaggtgatatcgaatccttgccgttcctcgaagcgattcgccagatg
gctgttgaaattggccgtgagcacactctgtttatgcacctgacgctggtgccgtacatg
gcagcgtctggtgaagtcaaaaccaaaccgactcagcactctgtaaaagagctgctctcc
atcggtatccagcctgacatcctgatttgtcgttcagatcgcgctgttccggcgaacgaa
cgtgcgaagattgcattgttctgtaatgttccggaaaaagcggttatttctctgaaagac
gtcgattccatctataaaattccgggcctgttgaaatctcaggggctggacgattatatt
tgtaaacgattcagcttaaactgcccggaagcgaatctgtccgaatgggaacaggttatc
ttcgaagaagcgaacccggtaagtgaagtcaccatcggtatggtcggcaagtacattgaa
ctgccggatgcttataaatcagtgatcgaagcactgaaacacggtgggctgaagaatcgt
gtcagcgtcaacatcaaactgatcgattcacaagatgttgaaacgcgcggcgttgaaatc
cttaaaggtctggacgcaatcctcgtacctggcggtttcggctatcgtggcgtagaaggc
atgattacgaccgcgcgttttgcgcgtgagaacaatattccttatctgggcatttgcctg
ggtatgcaggtggcgttaattgattacgctcgccatgttgccaacatggagaacgccaac
tctacggaatttgtgccagactgtaagtacccggttgtggcgctgattaccgagtggcgc
gatgaaaacggcaacgttgaagttcgtagcgagaagagcgatctcggcggtaccatgcgt
ctcggcgcacagcagtgccagttggttgacgatagcctggttcgccagctgtacaatgcg
ccgacaattgttgagcgtcatcgtcaccgttacgaagtcaacaacatgctgttgaaacag
attgaagatgcaggtctgcgcgttgcgggccgttccggggatgatcagttggtcgagatc
atcgaagttccgaatcacccgtggttcgtggcttgccagttccatccggagtttacttct
actccacgtgatggtcacccgctgtttgcaggctttgtgaaagccgccagcgagttccag
aaacgtcaggcgaagtaa

DBGET integrated database retrieval system