KEGG   Escherichia coli K-12 MG1655: b2806Help
Entry
b2806             CDS       T00007                                 

Gene name
rlmM
Definition
23S rRNA C2498 2'-O-ribose methyltransferase, SAM-dependent
Orthology
K06968  
23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     b2806 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2940143..2941243)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELP
FSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFC
RKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgtattgctgtgccgtccgggctttgaaaaagagtgcgccgcagaaatt
accgataaagccggccagcgggaaattttcggttttgcccgcgtgaaagagaatgcgggt
tatgtcatttatgaatgttatcaacctgatgatggcgataagttaatccgtgagctgccg
ttcagttcattaatttttgcccgccagtggtttgtggtgggggaactcctgcagcatttg
ccgccagaagatcgtattacccccattgtcggcatgttacagggcgtagtagagaagggc
ggtgaactgcgtgttgaagttgccgataccaacgaaagcaaagagttactgaaattctgc
cgtaaatttactgttccgctacgcgctgccttgcgcgatgccggggtgctggcgaactat
gaaacgccgaagcgtccggttgtgcatgtattctttattgcaccaggctgctgctatacc
ggttactcatacagcaacaataattcgccgttctatatgggcattccgcgcctgaaattt
ccggcagatgcgccgagtcgttccacgctcaaactggaagaggcatttcatgtgtttatt
cctgcggatgagtgggatgaacgcctggcgaacgggatgtgggcggtggatttaggcgct
tgccctggcggctggacctaccaactggtgaagcgcaacatgtgggtttattccgtcgac
aacggcccgatggcgcaaagtctgatggataccggacaggtgacgtggctgcgggaagac
ggtttcaaattccgtccgacgcgcagcaatatctcctggatggtatgcgatatggttgaa
aaaccggcgaaagttgcggcattgatggcgcagtggctggttaatggctggtgccgtgaa
accattttcaacctcaaactgccgatgaaaaaacgctacgaagaagtgtcacacaatctg
gcgtatattcaggcacagcttgatgaacatggcataaatgctcagattcaggcgcggcag
ttgtatcacgatcgcgaagaagtgacggtgcacgtccgccgcatctgggctgcggtgggt
ggtcgtcgcgacgagcgataa

DBGET integrated database retrieval system