KEGG   Escherichia coli K-12 MG1655: b2835Help
Entry
b2835             CDS       T00007                                 

Gene name
lplT
Definition
(RefSeq) lysophospholipid transporter
  KO
K08227  
MFS transporter, LPLT family, lysophospholipid transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Lipid transporters
   Lysophospholipid transporter (LplT) family [TC:2.A.1.42]
    b2835 (lplT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(2972669..2973862)
Genome map
AA seq 397 aa AA seqDB search
MSESVHTNTSLWSKGMKAVIVAQFLSAFGDNALLFATLALLKAQFYPEWSQPILQMVFVG
AYILFAPFVGQVADSFAKGRVMMFANGLKLLGAASICFGINPFLGYTLVGVGAAAYSPAK
YGILGELTTGSKLVKANGLMEASTIAAILLGSVAGGVLADWHVLVALAACALAYGGAVVA
NIYIPKLAAARPGQSWNLINMTRSFLNACTSLWRNGETRFSLVGTSLFWGAGVTLRFLLV
LWVPVALGITDNATPTYLNAMVAIGIVVGAGAAAKLVTLETVSRCMPAGILIGVVVLIFS
LQHELLPAYALLMLIGVMGGFFVVPLNALLQERGKKSVGAGNAIAVQNLGENSAMLLMLG
IYSLAVMIGIPVVPIGIGFGALFALAITALWIWQRRH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtcagtgcacactaacacttcgttgtggtcgaaggggatgaaagcggttatc
gtggcgcagtttctctctgcgtttggcgataatgccctactgtttgccactctggcgtta
ctgaaagcgcagttctatccggagtggagccagcccatcctgcaaatggtgtttgtaggt
gcttacattctttttgcgccgtttgtcgggcaggtggcggatagcttcgccaaaggccgg
gtgatgatgtttgccaacggcctgaagctgctgggcgcagccagtatctgctttggtatc
aatccgtttctcggctatacgctggtgggtgttggtgctgcagcctattcaccggcgaaa
tacggtattctcggcgaattaaccacgggtagtaagttagtgaaagctaacggtttaatg
gaagcttctaccatagcggcgattttgctcggttccgtagccggtggtgtgctggctgac
tggcatgtcctcgtcgccctggccgcatgcgcactggcctacggtggtgcggtcgttgcc
aatatctacattcccaaactggcggcggcgcgtccggggcagtcctggaatctcatcaac
atgacccgcagtttcctgaatgcctgcacctcgctatggcgcaatggtgaaacgcgtttt
tcgctggtgggcaccagtttattctggggagcgggtgtcacgctgcgtttcctgttggtg
ctgtgggtaccggtggcgctgggcattaccgataacgctacgcccacctatctcaacgcg
atggtagcgattggtatcgtggttggcgcaggtgcggcagcgaagttagttacgctggaa
accgtgtcacgctgtatgccagccgggattttgattggcgtggtggtactgattttttcc
ctgcaacacgagctgctgccagcctatgccttgttgatgctgattggcgtgatggggggc
ttttttgtcgttccgctcaatgcgttgctacaggagcggggtaaaaaaagcgtcggggcg
gggaatgcgattgcagtacaaaaccttggcgaaaacagcgccatgttgttgatgctgggc
atttactcgctggcggtaatgataggcatcccggtcgtgcccattggcattggcttcggt
gcgctgtttgcgctggcaataacggcgctgtggatctggcagcgccgtcattaa

DBGET integrated database retrieval system