KEGG   Escherichia coli K-12 MG1655: b2839Help
Entry
b2839             CDS       T00007                                 

Gene name
lysR
Definition
(RefSeq) transcriptional activator of lysA; autorepressor
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2979021..2979956
Genome map
AA seq 311 aa AA seqDB search
MAAVNLRHIEIFHAVMTAGSLTEAAHLLHTSQPTVSRELARFEKVIGLKLFERVRGRLHP
TVQGLRLFEEVQRSWYGLDRIVSAAESLREFRQGELSIACLPVFSQSFLPQLLQPFLARY
PDVSLNIVPQESPLLEEWLSAQRHDLGLTETLHTPAGTERTELLSLDEVCVLPPGHPLAV
KKVLTPDDFQGENYISLSRTDSYRQLLDQLFTEHQVKRRMIVETHSAASVCAMVRAGVGI
SVVNPLTALDYAASGLVVRRFSIAVPFTVSLIRPLHRPSSALVQAFSGHLQAGLPKLVTS
LDAILSSATTA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgttaacttacgtcatattgaaatttttcatgcggtaatgaccgccggaagc
ctgactgaggcggcacacctgctacacacctcacagccaaccgtcagccgcgaacttgcg
cgctttgagaaggtgatcgggctgaaattgtttgagcgcgtacgtgggcgattacatcct
accgtgcaaggactgcgtctgtttgaagaagtgcaacgatcctggtacggactggatcgc
attgtcagcgccgcagaaagtctgcgcgagtttcgccagggagaactgtctattgcctgc
ctgccggtcttttcgcaatcttttttaccgcagctcctgcaaccctttctggcacgttat
cccgatgtcagcttaaatatcgtgccccaggaatcaccgctacttgaagagtggctctcg
gcccagcgtcatgatttaggactcactgaaacgctccatacgcctgcgggaacagaacgt
accgaattactctctttagatgaagtgtgtgtgttacctccgggtcatccgctggcggta
aaaaaggtattaacgccggatgattttcagggtgagaactacatcagcctttcccgtact
gacagctatcgccagttgctggatcagctatttactgaacatcaggttaaacgacgcatg
atcgtagaaacccacagcgccgcgtcagtctgcgcaatggtacgggcgggggtaggtatt
tcggtggttaacccgctcaccgcactagattatgcggcaagcggtttagtggtgcggcgg
ttcagtattgcggttccgttcaccgtcagcctgatccgccccctgcaccgcccgtcatca
gcgctggttcaggcgtttagtgggcatttacaagcggggttaccgaaactggtcacttct
cttgacgctattttgtcgtcagctacgacagcataa

DBGET integrated database retrieval system