KEGG   Escherichia coli K-12 MG1655: b2860Help
Entry
b2860             CDS       T00007                                 

Gene name
insD1
Definition
(RefSeq) IS2 transposase TnpB
  KO
K07497  
putative transposase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ASAP: 
UniProt: 
Position
complement(2996372..2997277)
Genome map
AA seq 301 aa AA seqDB search
MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVI
GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRV
AVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAV
ERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTI
KRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLE
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggatagcgcacgcgcccttattgcccggggatggggagtaagcttagtcagccgttgt
ctccgggtgtcgcgtgcgcagttgcacgtcattctcagacgaaccgatgactggatggat
ggccgccgcagtcgtcacactgatgatacggatgtgcttctccgtatacaccatgttatc
ggagagctgccaacgtatggttatcgtcgggtatgggcgctgcttcgcagacaggcagaa
cttgatggtatgcctgcgatcaatgccaaacgtgtttaccggatcatgcgccagaatgcg
ctgttgcttgagcgaaaacctgctgtaccgccatcgaaacgggcacatacaggcagagtg
gccgtgaaagaaagcaatcagcgatggtgctctgacgggttcgagttctgctgtgataac
ggagagagactgcgtgtcacgttcgcgctggactgctgtgatcgtgaggcactgcactgg
gcggtcactaccggcggcttcaacagtgaaacagtacaggacgtcatgctgggagcggtg
gaacgccgcttcggcaacgatcttccgtcgtctccagtggagtggctgacggataatggt
tcatgctaccgggctaatgaaacacgccagttcgcccggatgttgggacttgaaccgaag
aacacggcggtgcggagtccggagagtaacggaatagcagagagcttcgtgaaaacgata
aagcgtgactacatcagtatcatgcccaaaccagacgggttaacggcagcaaagaacctt
gcagaggcgttcgagcattataacgaatggcatccgcatagtgcgctgggttatcgctcg
ccacgggaatatctgcggcagcgggcttgtaatgggttaagtgataacagatgtctggaa
atatag

DBGET integrated database retrieval system