KEGG   Escherichia coli K-12 MG1655: b2873Help
Entry
b2873             CDS       T00007                                 

Gene name
hyuA
Definition
(RefSeq) D-stereospecific phenylhydantoinase
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00240  Pyrimidine metabolism
eco00410  beta-Alanine metabolism
eco00770  Pantothenate and CoA biosynthesis
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    b2873 (hyuA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    b2873 (hyuA)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b2873 (hyuA)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     b2873 (hyuA)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   b2873 (hyuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 947359
NCBI-ProteinID: NP_417349
Pasteur: ygeZ
RegulonDB: ECK120004055
ECOCYC: G7492
ASAP: ABE-0009436
UniProt: Q46806
Position
3010028..3011413
Genome map
AA seq 461 aa AA seqDB search
MRVLIKNGTVVNADGQAKQDLLIESGIVRQLGNNISPQLPYEEIDATGCYVFPGGVDVHT
HFNIDVGIARSCDDFFTGTRAAACGGTTTIIDHMGFGPNGCRLRHQLEVYRGYAAHKAVI
DYSFHGVIQHINHAILDEIPMIVEEGLSSFKLYLTYQYKLNDDEVLQALRRLHESGALTT
VHPENDAAIASKRAEFIAAGLTAPRYHALSRPLECEAEAIARMINLAQIAGNAPLYIVHL
SNGLGLDYLRLARANHQPVWVETCPQYLLLDERSYDTEDGMKFILSPPLRNVREQDKLWC
GISDGAIDVVATDHCTFSMAQRLQISKGDFSRCPNGLPGVENRMQLLFSSGVMTGRITPE
RFVELTSAMPARLFGLWPQKGLLAPGSDGDVVIIDPRQSQQIQHRHLHDNADYSPWEGFT
CQGAIVRTLSRGETIFCDGTFTGKAGRGRFLRRKPFVPPVL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtattgatcaaaaacggcactgtcgttaacgcagatggacaagccaaacaggat
ttgctgattgaaagcgggattgttcgccagttgggcaacaatatttcgccgcagctcccg
tatgaagaaattgatgccactggctgttacgttttccctggcggcgtggatgtccatacg
catttcaatattgatgtcggcatcgcgcgcagttgtgatgatttttttaccggtacccgc
gcagctgcgtgtggcggtacaacaaccattattgaccatatgggatttggcccaaacggc
tgtcggttacgccatcaactggaggtttatcgtggttatgccgcccataaagcggtcatc
gattacagctttcacggtgtgatccagcacattaatcacgcaatcctcgacgaaatcccg
atgatagtcgaggaaggactgagcagttttaaactctatttaacctatcaatacaaactc
aacgatgacgaggttttgcaggcattacgccgcttgcatgaatccggcgcgctgaccacc
gtgcacccggaaaatgatgcggctatcgccagcaagcgggcggaatttatcgccgcaggg
ttaaccgcgccgcgctatcatgccttgagtcgccctctggaatgcgaagcggaagccatc
gcccgcatgattaacctggcacaaattgccggtaacgccccgctctatatcgtgcacctg
tctaacggcttaggtctggattatctgcgtcttgcccgtgcgaatcaccagccagtctgg
gttgaaacctgcccacaatatctcctgttggacgaacgcagttacgatacagaagatggc
atgaagttcattcttagcccaccgctgcgtaacgtacgcgagcaggacaaactgtggtgt
ggcatcagcgatggtgcgattgacgtggtggcaaccgatcactgcaccttctcgatggct
caacgcctgcaaatttctaaaggcgatttcagtcgctgcccaaatggcttacccggtgtg
gaaaaccgcatgcagttactgttttccagtggcgtgatgacgggacgtataacaccggaa
cgctttgttgaattaaccagcgcaatgcccgccaggttgtttggcctgtggccgcaaaaa
ggattattagcgcccggttccgacggcgacgtggtgattatcgacccacgtcagagccaa
caaattcagcatcgccatctccacgacaacgccgactactcgccatgggagggttttacc
tgtcagggcgcgattgtcagaaccttatcccgtggtgaaacgattttctgtgacggcacc
tttacaggcaaagccgggcgaggtcgtttcctgcgacgcaaaccgtttgtccctcccgtg
ctctaa

DBGET integrated database retrieval system