KEGG   Escherichia coli K-12 MG1655: b2875Help
Entry
b2875             CDS       T00007                                 

Gene name
yqeB
Definition
conserved protein with NAD(P)-binding Rossman fold
Orthology
K07402  
xanthine dehydrogenase accessory factor
Organism
eco  Escherichia coli K-12 MG1655
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3012614..3014239)
Genome map
AA seq 541 aa AA seqDB search
MNIFTEAAKLEEQNCPFAMAQIVDSRGSTPRHSAQMLVRADGSIVGTIGGGMVERKVIEE
SLQALQERKPRLFHGRMARNGADAVGSDCGGAMSVFISVHGMRPRLVLIGAGHVNRAIAQ
SAALLGFDIAVADIYRESLNPELFPPSTTLLHAESFGAAVEALDIRPDNFVLIATNNQDR
EALDKLIEQPIAWLGLLASRRKVQLFLRQLREKGVAEEHIARLHAPVGYNIGAETPQEIA
ISVLAEILQVKNNAPGGLMMKPSHPSGHQLVVIRGAGDIASGVALRLYHAGFKVIMLEVE
KPTVIRCTVAFAQAVFDGEMTVEGVTARLATSSAEAMKLTERGFIPVMVDPACSLLDELK
PLCVVDAILAKQNLGTRADMAPVTIALGPGFTAGKDCHAVIETNRGHWLGQVIYSGCAQE
NTGVPGNIMGHTTRRVIRAPAAGIMRSNVKLGDLVKEGDVIAWIGEHEIKAPLTGMVRGL
LNDGLAVVGGFKIGDIDPRGETADFTSVSDKARAIGGGVLEALMMLMHQGVKATKEVLEV
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttcacagaggctgcaaaactcgaagagcaaaattgtccgtttgctatggcg
caaattgttgatagccgaggctcgactccccgccattctgcacaaatgttagtgcgcgcc
gatggttctatcgtcggtacaattggtggcggaatggttgagcggaaggtgattgaagag
tcgcttcaggcattgcaggaacgtaagccgcgattattccatggacgtatggctcgtaac
ggtgcggatgctgtcgggtcagattgtggaggtgcaatgtcagtatttatcagcgtccat
ggtatgcgtccacgtctggtgttgattggcgcggggcatgtcaaccgggcgatagcccag
agtgcggcgctattaggatttgatattgccgttgctgatatttatcgcgaaagcctcaat
cctgaactattcccaccatcaaccacgcttctccatgctgagtcgtttggtgcggcagtg
gaagcactggatattcgccctgataattttgtcctgattgccacgaataatcaggatcgt
gaagccctcgacaaactcattgaacagcccattgcatggttggggttgctggcaagtcgt
cgcaaggttcagcttttcctgcgtcaattgcgtgagaaaggcgtggctgaagaacatatt
gcccgtttacatgcgcccgttggttacaacataggtgcggaaacgccgcaggagatcgcc
atcagcgtgctggcagaaatattacaggtgaaaaataacgcgccgggtgggctgatgatg
aaaccttctcatccttccggacaccagctggtggtgattcgcggtgcgggagatatcgcc
agtggtgtggcgctacgtctgtatcatgcgggttttaaagtgatcatgctggaagtggaa
aaaccgacagtgattcgttgtaccgtggcgtttgcccaggccgtgttcgatggcgaaatg
acggtcgaaggcgtcactgctcgcctggcaaccagctctgcggaagcgatgaaacttacc
gaacgcggattcattcctgtgatggtagatcccgcctgttcattgcttgatgaactgaaa
ccgctttgcgtggtggacgctattctggcgaaacagaatttgggaacgcgggcagatatg
gcaccagtaacaatcgcgcttgggccgggctttactgctgggaaggattgtcatgcggta
attgaaacaaatcgcgggcactggctcggtcaggtgatttactctggttgtgcgcaggag
aataccggtgttcctggcaatattatggggcataccacccgacgggtgatccgtgctcct
gctgcaggcattatgcgatccaacgtgaaattaggcgatctggtgaaagagggcgatgtg
attgcctggattggtgagcatgaaattaaagcaccgttgacggggatggtgcgtggcttg
ttgaacgacggcctggcagtggttggtggttttaaaattggtgatatcgatcctcgtggt
gaaaccgctgatttcaccagcgtttctgataaagcccgggcgattggcggcggcgtactt
gaggcgttaatgatgttgatgcatcagggcgtgaaagcgacaaaagaagtgctggaagtg
gcttaa

DBGET integrated database retrieval system