KEGG   Escherichia coli K-12 MG1655: b2875Help
Entry
b2875             CDS       T00007                                 

Gene name
yqeB
Definition
(RefSeq) XdhC-CoxI family protein with NAD(P)-binding Rossman fold
  KO
K07402  xanthine dehydrogenase accessory factor
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XdhC_C XdhC_CoxI 2-Hacid_dh_C 3HCDH_N F420_oxidored Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 947357
NCBI-ProteinID: NP_417351
Pasteur: yqeB
RegulonDB: ECK120004057
ECOCYC: G7494
ASAP: ABE-0009441
UniProt: Q46808
Position
complement(3012614..3014239)
Genome map
AA seq 541 aa AA seqDB search
MNIFTEAAKLEEQNCPFAMAQIVDSRGSTPRHSAQMLVRADGSIVGTIGGGMVERKVIEE
SLQALQERKPRLFHGRMARNGADAVGSDCGGAMSVFISVHGMRPRLVLIGAGHVNRAIAQ
SAALLGFDIAVADIYRESLNPELFPPSTTLLHAESFGAAVEALDIRPDNFVLIATNNQDR
EALDKLIEQPIAWLGLLASRRKVQLFLRQLREKGVAEEHIARLHAPVGYNIGAETPQEIA
ISVLAEILQVKNNAPGGLMMKPSHPSGHQLVVIRGAGDIASGVALRLYHAGFKVIMLEVE
KPTVIRCTVAFAQAVFDGEMTVEGVTARLATSSAEAMKLTERGFIPVMVDPACSLLDELK
PLCVVDAILAKQNLGTRADMAPVTIALGPGFTAGKDCHAVIETNRGHWLGQVIYSGCAQE
NTGVPGNIMGHTTRRVIRAPAAGIMRSNVKLGDLVKEGDVIAWIGEHEIKAPLTGMVRGL
LNDGLAVVGGFKIGDIDPRGETADFTSVSDKARAIGGGVLEALMMLMHQGVKATKEVLEV
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttcacagaggctgcaaaactcgaagagcaaaattgtccgtttgctatggcg
caaattgttgatagccgaggctcgactccccgccattctgcacaaatgttagtgcgcgcc
gatggttctatcgtcggtacaattggtggcggaatggttgagcggaaggtgattgaagag
tcgcttcaggcattgcaggaacgtaagccgcgattattccatggacgtatggctcgtaac
ggtgcggatgctgtcgggtcagattgtggaggtgcaatgtcagtatttatcagcgtccat
ggtatgcgtccacgtctggtgttgattggcgcggggcatgtcaaccgggcgatagcccag
agtgcggcgctattaggatttgatattgccgttgctgatatttatcgcgaaagcctcaat
cctgaactattcccaccatcaaccacgcttctccatgctgagtcgtttggtgcggcagtg
gaagcactggatattcgccctgataattttgtcctgattgccacgaataatcaggatcgt
gaagccctcgacaaactcattgaacagcccattgcatggttggggttgctggcaagtcgt
cgcaaggttcagcttttcctgcgtcaattgcgtgagaaaggcgtggctgaagaacatatt
gcccgtttacatgcgcccgttggttacaacataggtgcggaaacgccgcaggagatcgcc
atcagcgtgctggcagaaatattacaggtgaaaaataacgcgccgggtgggctgatgatg
aaaccttctcatccttccggacaccagctggtggtgattcgcggtgcgggagatatcgcc
agtggtgtggcgctacgtctgtatcatgcgggttttaaagtgatcatgctggaagtggaa
aaaccgacagtgattcgttgtaccgtggcgtttgcccaggccgtgttcgatggcgaaatg
acggtcgaaggcgtcactgctcgcctggcaaccagctctgcggaagcgatgaaacttacc
gaacgcggattcattcctgtgatggtagatcccgcctgttcattgcttgatgaactgaaa
ccgctttgcgtggtggacgctattctggcgaaacagaatttgggaacgcgggcagatatg
gcaccagtaacaatcgcgcttgggccgggctttactgctgggaaggattgtcatgcggta
attgaaacaaatcgcgggcactggctcggtcaggtgatttactctggttgtgcgcaggag
aataccggtgttcctggcaatattatggggcataccacccgacgggtgatccgtgctcct
gctgcaggcattatgcgatccaacgtgaaattaggcgatctggtgaaagagggcgatgtg
attgcctggattggtgagcatgaaattaaagcaccgttgacggggatggtgcgtggcttg
ttgaacgacggcctggcagtggttggtggttttaaaattggtgatatcgatcctcgtggt
gaaaccgctgatttcaccagcgtttctgataaagcccgggcgattggcggcggcgtactt
gaggcgttaatgatgttgatgcatcagggcgtgaaagcgacaaaagaagtgctggaagtg
gcttaa

DBGET integrated database retrieval system