KEGG   Escherichia coli K-12 MG1655: b2893Help
Entry
b2893             CDS       T00007                                 

Gene name
dsbC
Definition
protein disulfide isomerase II (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eco  Escherichia coli K-12 MG1655
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3038112..3038822)
Genome map
AA seq 236 aa AA seqDB search
MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttttatgttgtttactttgttagcggcgttttcaggctttgctcaggct
gatgacgcggcaattcaacaaacgttagccaaaatgggcatcaaaagcagcgatattcag
cccgcgcctgtagctggcatgaagacagttctgactaacagcggcgtgttgtacatcacc
gatgatggtaaacatatcattcaggggccaatgtatgacgttagtggcacggctccggtc
aatgtcaccaataagatgctgttaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcgccgcaggaaaaacacgtcatcaccgtgtttactgatattacctgtggttac
tgccacaaactgcatgagcaaatggcagactacaacgcgctggggatcaccgtgcgttat
cttgctttcccgcgccaggggctggacagcgatgcagagaaagaaatgaaagctatctgg
tgtgcgaaagataaaaacaaagcgtttgatgatgtgatggcaggtaaaagcgtcgcacca
gccagttgcgacgtggatattgccgaccattacgcacttggcgtccagcttggcgttagc
ggtactccggcagttgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gagatgaaagaattcctcgacgaacaccaaaaaatgaccagcggtaaataa

DBGET integrated database retrieval system