KEGG   Escherichia coli K-12 MG1655: b2895Help
Entry
b2895             CDS       T00007                                 

Gene name
fldB
Definition
(RefSeq) flavodoxin 2
  KO
K03840  flavodoxin II
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_1 Flavodoxin_3
Motif
Other DBs
NCBI-GeneID: 947361
NCBI-ProteinID: NP_417371
Pasteur: fldB
RegulonDB: ECK120002360
ECOCYC: EG12697
ASAP: ABE-0009503
UniProt: P0ABY4
Structure
PDB: 

Jmol
Position
3039855..3040376
Genome map
AA seq 173 aa AA seqDB search
MNMGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPKLMEQYDVLILGIPTWDFGE
IQEDWEAVWDQLDDLNLEGKIVALYGLGDQLGYGEWFLDALGMLHDKLSTKGVKFVGYWP
TEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQSWCEQILNEMAEHYA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgggtcttttttacggttccagcacctgttacaccgaaatggcggcagaaaaa
atccgcgatattatcggcccagaactggtgaccttacataacctcaaggacgactccccg
aaattaatggagcagtacgatgtgctcattctgggtatcccgacctgggattttggtgaa
atccaggaagactgggaagccgtctgggatcagctcgacgacctgaaccttgaaggtaaa
attgttgcgctgtatgggcttggcgatcaactgggatacggcgagtggttcctcgatgcg
ctcggtatgctgcatgacaaactctcgaccaaaggcgtgaagttcgtcggctactggcca
acggaaggatatgaatttaccagcccgaaaccggtgattgctgacgggcaactgttcgtg
ggtctggcgctggatgaaactaaccagtatgaccttagcgacgagcgtattcagagctgg
tgcgagcaaatcctcaacgaaatggcagagcattacgcctga

DBGET integrated database retrieval system