KEGG   Escherichia coli K-12 MG1655: b2896Help
Entry
b2896             CDS       T00007                                 

Gene name
cptA
Definition
(RefSeq) toxin of CptAB toxin-antitoxin pair
  KO
K19168  
toxin CptA
Organism
eco  Escherichia coli K-12 MG1655
Brite
Prokaryotic defense system [BR:eco02048]
 Toxin-antitoxin system (TA system)
  Type IV TA system
   CptA-CptB
    b2896 (cptA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3040416..3040823)
Genome map
AA seq 135 aa AA seqDB search
MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRI
NARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAE
WRDLRRILLQQETQR
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
gtggtcctgtggcaatctgatttgcgcgtctcctggcgcgcacagtggctttccttgctg
attcatgggctggttgccgctgttattttactcatgccctggccactcagttacaccccg
ttatggatggtgttactttcgctggtggtgtttgattgcgttcgcagccagcggcgtatt
aatgctcgccagggggaaattcgcttgttgatggacgggcgtttgcgttggcaagggcag
gagtggagcatcgtcaaagcaccgtggatgattaagagcggcatgatgctgcgtttacgt
tctgatggcggtaaacggcaacatttatggctggcagccgacagcatggacgaagctgaa
tggcgggatttacggcggattttgttgcaacaagagacgcaaagataa

DBGET integrated database retrieval system