KEGG   Escherichia coli K-12 MG1655: b2905Help
Entry
b2905             CDS       T00007                                 

Gene name
gcvT
Definition
(RefSeq) aminomethyltransferase, tetrahydrofolate-dependent, subunit (T protein) of glycine cleavage complex
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00260  Glycine, serine and threonine metabolism
eco00630  Glyoxylate and dicarboxylate metabolism
eco00670  One carbon pool by folate
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b2905 (gcvT)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b2905 (gcvT)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    b2905 (gcvT)
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     b2905 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-GeneID: 947390
NCBI-ProteinID: NP_417381
Pasteur: gcvT
RegulonDB: ECK120001406
ECOCYC: EG11442
ASAP: ABE-0009536
UniProt: P27248
Structure
PDB: 

Jmol
Position
complement(3049573..3050667)
Genome map
AA seq 364 aa AA seqDB search
MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGS
RTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREK
DLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQAG
DLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQEM
DETISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVMTEKGVLRNELPVRF
TDAQGNQHEGIITSGTFSPTLGYSIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNG
KAVA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacagactcctttgtacgaacaacacacgctttgcggcgctcgcatggtggat
ttccacggctggatgatgccgctgcattacggttcgcaaatcgacgaacatcatgcggta
cgtaccgatgccggaatgtttgatgtgtcacatatgaccatcgtcgatcttcgcggcagc
cgcacccgggagtttctgcgttatctgctggcgaacgatgtggcgaagctcaccaaaagc
ggcaaagccctttactcggggatgttgaatgcctctggcggtgtgatagatgacctcatc
gtctactactttactgaagatttcttccgcctcgttgttaactccgccacccgcgaaaaa
gacctctcctggattacccaacacgctgaacctttcggcatcgaaattaccgttcgtgat
gacctttccatgattgccgtgcaagggccgaatgcgcaggcaaaagctgccacactgttt
aatgacgcccagcgtcaggcggtggaagggatgaaaccgttctttggcgtgcaggcgggc
gatctgtttattgccaccactggttataccggtgaagcgggctatgaaattgcgctgccc
aatgaaaaagcggccgatttctggcgtgcgctggtggaagcgggtgttaagccatgtggc
ttgggcgcgcgtgacacgctgcgtctggaagcgggcatgaatctttatggtcaggagatg
gacgaaaccatctctcctttagccgccaacatgggctggaccatcgcctgggaaccggca
gatcgtgactttatcggtcgtgaagccctggaagtgcagcgtgagcatggtacagaaaaa
ctggttggtctggtgatgaccgaaaaaggcgtgctgcgtaatgaactgccggtacgcttt
accgatgcgcagggcaaccagcatgaaggcattatcaccagcggtactttctccccgacg
ctgggttacagcattgcgctggcgcgcgtgccggaaggtattggcgaaacggcgattgtg
caaattcgcaaccgtgaaatgccggttaaagtgacaaaacctgtttttgtgcgtaacggc
aaagccgtcgcgtga

DBGET integrated database retrieval system