KEGG   Escherichia coli K-12 MG1655: b2914Help
Entry
b2914             CDS       T00007                                 

Gene name
rpiA
Definition
(RefSeq) ribose 5-phosphate isomerase, constitutive (EC:5.3.1.6)
  KO
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b2914 (rpiA)
   01230 Biosynthesis of amino acids
    b2914 (rpiA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    b2914 (rpiA)
Enzymes [BR:eco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     b2914 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3058666..3059325)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAALTREKIIASVAEKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGMEILDPI
AMENAINAIPGVVTVGLFANRGADVALIGTPDGVKTIVK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaattgaaaaaagcagtaggatgggcggcacttcagtatgttcagccc
ggcaccattgttggtgtaggtacaggttccaccgccgcacactttattgacgcgctcggt
acaatgaaaggccagattgaaggggccgtttccagttcagatgcttccactgaaaaactg
aaaagcctcggcattcacgtttttgatctcaacgaagtcgacagccttggcatctacgtt
gatggcgcagatgaaatcaacggccacatgcaaatgatcaaaggcggcggcgcggcgctg
acccgtgaaaaaatcattgcttcggttgcagaaaaatttatctgtattgcagacgcttcc
aagcaggttgatattctgggtaaattcccgctgccagtagaagttatcccgatggcacgt
agtgcagtggcgcgtcagctggtgaaactgggcggtcgtccggaataccgtcagggcgtg
gtgaccgataatggcaacgtgatcctcgacgtccacggcatggaaatccttgacccgata
gcgatggaaaacgccataaatgcgattcctggcgtggtgactgttggcttgtttgctaac
cgtggcgcggacgttgcgctgattggcacacctgacggtgtcaaaaccattgtgaaatga

DBGET integrated database retrieval system