KEGG   Escherichia coli K-12 MG1655: b2916Help
Entry
b2916             CDS       T00007                                 

Gene name
argP
Definition
(RefSeq) transcriptional regulator for arginine transport and DNA replication genes; replication initiation inhibitor
  KO
K05596  
LysR family transcriptional regulator, chromosome initiation inhibitor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    b2916 (argP)
Chromosome [BR:eco03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    b2916 (argP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3059753..3060646
Genome map
AA seq 297 aa AA seqDB search
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPT
EQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLATWLLPALAPVLADSPIR
LNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALDYLFVSSKPFAEKYFPNG
VTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVNSSEAFVQLARQGTTCCMI
PHLQIEKELASGELIDLTPGLFQRRMLYWHRFAPESRMMRKVTDALLDYGHKVLRQD
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcccggactacagaacattacaggcactggatgcggtgatacgtgaacgagga
tttgagcgcgcggcacaaaagctgtgcattacacaatcagccgtctcacagcgcattaag
caactggaaaatatgttcgggcagccgctgttggtgcgtaccgtaccgccgcgcccgacg
gaacaagggcaaaaactgctggcactgctgcgccaggtggagttgctggaagaagagtgg
ctgggcgatgaacaaaccggttcgactccgctgctgctttcactggcggtcaacgccgac
agtctggcgacgtggttgcttcctgcactggctcctgtgttggctgattcgcctatccgc
ctcaacttgcaggtagaagatgaaacccgcactcaggaacgtctgcgccgcggcgaagtg
gtcggcgcggtgagtattcaacatcaggcgctgccgagttgtcttgtcgataaacttggt
gcgctcgactatctgttcgtcagctcaaaaccctttgccgaaaaatatttccctaacggc
gtaacgcgttcggcattactgaaagcgccagtggtcgcgtttgaccatcttgacgatatg
caccaggcctttttgcagcaaaacttcgatctgcctccaggcagcgtgccctgccatatc
gttaattcttcagaagcgttcgtacaacttgctcgccagggcaccacctgctgtatgatc
ccgcacctgcaaatcgagaaagagctggccagcggtgaactgattgacttaacgcctggg
ctatttcaacgacggatgctctactggcaccgctttgctcctgaaagccgcatgatgcgt
aaagtcactgatgcgttactcgattatggtcacaaagtccttcgtcaggattaa

DBGET integrated database retrieval system