KEGG   Escherichia coli K-12 MG1655: b2916Help
Entry
b2916             CDS       T00007                                 

Gene name
argP
Definition
(RefSeq) transcriptional regulator for arginine transport and DNA replication genes; replication initiation inhibitor
  KO
K05596  LysR family transcriptional regulator, chromosome initiation inhibitor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    b2916 (argP)
Chromosome and associated proteins [BR:eco03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    b2916 (argP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_1 LysR_substrate HTH_30
Motif
Other DBs
NCBI-GeneID: 944867
NCBI-ProteinID: NP_417391
Pasteur: argP
RegulonDB: ECK120000483
ECOCYC: EG10490
ASAP: ABE-0009574
UniProt: P0A8S1
Position
3059753..3060646
Genome map
AA seq 297 aa AA seqDB search
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPT
EQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLATWLLPALAPVLADSPIR
LNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALDYLFVSSKPFAEKYFPNG
VTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVNSSEAFVQLARQGTTCCMI
PHLQIEKELASGELIDLTPGLFQRRMLYWHRFAPESRMMRKVTDALLDYGHKVLRQD
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcccggactacagaacattacaggcactggatgcggtgatacgtgaacgagga
tttgagcgcgcggcacaaaagctgtgcattacacaatcagccgtctcacagcgcattaag
caactggaaaatatgttcgggcagccgctgttggtgcgtaccgtaccgccgcgcccgacg
gaacaagggcaaaaactgctggcactgctgcgccaggtggagttgctggaagaagagtgg
ctgggcgatgaacaaaccggttcgactccgctgctgctttcactggcggtcaacgccgac
agtctggcgacgtggttgcttcctgcactggctcctgtgttggctgattcgcctatccgc
ctcaacttgcaggtagaagatgaaacccgcactcaggaacgtctgcgccgcggcgaagtg
gtcggcgcggtgagtattcaacatcaggcgctgccgagttgtcttgtcgataaacttggt
gcgctcgactatctgttcgtcagctcaaaaccctttgccgaaaaatatttccctaacggc
gtaacgcgttcggcattactgaaagcgccagtggtcgcgtttgaccatcttgacgatatg
caccaggcctttttgcagcaaaacttcgatctgcctccaggcagcgtgccctgccatatc
gttaattcttcagaagcgttcgtacaacttgctcgccagggcaccacctgctgtatgatc
ccgcacctgcaaatcgagaaagagctggccagcggtgaactgattgacttaacgcctggg
ctatttcaacgacggatgctctactggcaccgctttgctcctgaaagccgcatgatgcgt
aaagtcactgatgcgttactcgattatggtcacaaagtccttcgtcaggattaa

DBGET integrated database retrieval system