KEGG   Escherichia coli K-12 MG1655: b2923Help
Entry
b2923             CDS       T00007                                 

Gene name
argO
Definition
(RefSeq) arginine transporter
  KO
K06895  
L-lysine exporter family protein LysE/ArgO
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b2923 (argO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3068173..3068808)
Genome map
AA seq 211 aa AA seqDB search
MFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSA
LLMQSPWLLALVTWGGVAFLLWYGFGAFKTAMSSNIELASAEVMKQGRWKIIATMLAVTW
LNPHVYLDTFVVLGSLGGQLDVEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTAKAQ
RIINLVVGCVMWFIALQLARDGIAHAQALFS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgttttcttattactttcaaggtcttgcacttggggcggctatgatcctaccgctcggt
ccacaaaatgcttttgtgatgaatcagggcatacgtcgtcagtaccacattatgattgcc
ttactttgtgctatcagcgatttggtcctgatttgcgccgggatttttggtggcagcgcg
ttattgatgcagtcgccgtggttgctggcgctggtcacctggggcggcgtagccttcttg
ctgtggtatggttttggcgcttttaaaacagcaatgagcagtaatattgagttagccagc
gccgaagtcatgaagcaaggcagatggaaaattatcgccaccatgttggcagtgacctgg
ctgaatccgcatgtttacctggatacttttgttgtactgggcagccttggcgggcaactt
gatgtggaaccaaaacgctggtttgcactcgggacaattagcgcctctttcctgtggttc
tttggtctggctcttctcgcagcctggctggcaccgcgtctgcgcacggcaaaagcacag
cgcattatcaatctggttgtgggatgtgttatgtggtttattgccttgcagctggcgaga
gacggtattgctcatgcacaagccttgttcagttag

DBGET integrated database retrieval system