KEGG   Escherichia coli K-12 MG1655: b2924Help
Entry
b2924             CDS       T00007                                 

Gene name
mscS
Definition
(RefSeq) mechanosensitive channel protein, small conductance
  KO
K03442  
small conductance mechanosensitive channel
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b2924 (mscS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3068947..3069807)
Genome map
AA seq 286 aa AA seqDB search
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggaagatttgaatgttgtcgatagcataaacggcgcgggaagctggctggtagctaac
caggcgctgctgctaagttatgcagtaaacatcgtggcggcactcgcgatcatcatcgtt
ggtttgattatcgcgcggatgatttccaacgcggtgaatcgcctgatgatctcccgtaaa
atcgatgccactgttgctgattttctttctgcattagtccgttacggtattatcgccttt
acgctaatcgctgcactgggacgcgtgggtgtacaaaccgcgtcagtcattgctgtactc
ggtgccgcaggcttagctgttggtctggctttgcaggggtcactgtctaacctggccgct
ggcgtgttacttgtcatgttccgcccgttccgtgccggagaatatgttgacctgggcggc
gtagccggtactgtgctgagtgtgcagattttctccaccaccatgcgtactgcagacggt
aaaattatcgttattccgaacggtaaaattattgccggaaatattattaacttctcccgc
gagccagttcgccgtaacgaatttattattggcgtggcgtatgattccgatatcgatcag
gttaagcagatcctgaccaatattatccagtctgaagatcgcattttgaaagatcgcgaa
atgactgtgcgcctgaacgaacttggtgcatcgtcgattaatttcgtggtccgcgtctgg
agcaacagcggcgatctgcaaaacgtgtactgggatgtgctggagcgtattaaacgtgaa
tttgatgccgccggtatcagcttcccgtacccgcaaatggatgtgaactttaagcgggtg
aaagaagacaaagctgcgtaa

DBGET integrated database retrieval system