KEGG   Escherichia coli K-12 MG1655: b2943Help
Entry
b2943             CDS       T00007                                 

Gene name
galP
Definition
(RefSeq) D-galactose transporter
  KO
K08137  
MFS transporter, SP family, galactose:H+ symporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    b2943 (galP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3088284..3089678
Genome map
AA seq 464 aa AA seqDB search
MPDAKKQGRSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSS
MMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVG
VASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIP
AILLLIGVFFLPDSPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQSGWA
LFKENSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTVIVGLTN
VLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFAIAMLLMFIV
GFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTLGNANTFWV
YAALNVLFILLTLWLVPETKHVSLEHIERNLMKGRKLREIGAHD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgctaaaaaacaggggcggtcaaacaaggcaatgacgtttttcgtctgcttc
cttgccgctctggcgggattactctttggcctggatatcggtgtaattgctggcgcactg
ccgtttattgcagatgaattccagattacttcgcacacgcaagaatgggtcgtaagctcc
atgatgttcggtgcggcagtcggtgcggtgggcagcggctggctctcctttaaactcggg
cgcaaaaagagcctgatgatcggcgcaattttgtttgttgccggttcgctgttctctgcg
gctgcgccaaacgttgaagtactgattctttcccgcgttctactggggctggcggtgggt
gtggcctcttataccgcaccgctgtacctctctgaaattgcgccggaaaaaattcgtggc
agtatgatctcgatgtatcagttgatgatcactatcgggatcctcggtgcttatctttct
gataccgccttcagctacaccggtgcatggcgctggatgctgggtgtgattatcatcccg
gcaattttgctgctgattggtgtcttcttcctgccagacagcccacgttggtttgccgcc
aaacgccgttttgttgatgccgaacgcgtgctgctacgcctgcgtgacaccagcgcggaa
gcgaaacgcgaactggatgaaatccgtgaaagtttgcaggttaaacagagtggctgggcg
ctgtttaaagagaacagcaacttccgccgcgcggtgttccttggcgtactgttgcaggta
atgcagcaattcaccgggatgaacgtcatcatgtattacgcgccgaaaatcttcgaactg
gcgggttataccaacactaccgagcaaatgtgggggaccgtgattgtcggcctgaccaac
gtacttgccacctttatcgcaatcggccttgttgaccgctggggacgtaaaccaacgcta
acgctgggcttcctggtgatggctgctggcatgggcgtactcggtacaatgatgcatatc
ggtattcactctccgtcggcgcagtatttcgccatcgccatgctgctgatgtttattgtc
ggttttgccatgagtgccggtccgctgatttgggtactgtgctccgaaattcagccgctg
aaaggccgcgattttggcatcacctgctccactgccaccaactggattgccaacatgatc
gttggcgcaacgttcctgaccatgctcaacacgctgggtaacgccaacaccttctgggtg
tatgcggctctgaacgtactgtttatcctgctgacattgtggctggtaccggaaaccaaa
cacgtttcgctggaacatattgaacgtaatctgatgaaaggtcgtaaactgcgcgaaata
ggcgctcacgattaa

DBGET integrated database retrieval system