KEGG   Escherichia coli K-12 MG1655: b2944Help
Entry
b2944             CDS       T00007                                 

Gene name
yggI
Definition
(RefSeq) Zn-dependent metalloprotease-related protein
  KO
K02742  
SprT protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3089755..3090252
Genome map
AA seq 165 aa AA seqDB search
MKTSRLPIAIQQAVMRRLREKLAQANLKLGRNYPEPKLSYTQRGTSAGTAWLESYEIRLN
PVLLLENSEAFIEEVVPHELAHLLVWKHFGRVAPHGKEWKWMMENVLGVPARRTHQFELQ
SVRRNTFPYRCKCQEHQLTVRRHNRVVRGEAVYRCVHCGEQLVAK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatcccgtctccctatcgccatccaacaggccgttatgcgtcgcctgcgggaa
aaactcgcccaggccaacctgaagctagggcgtaactacccggagccaaaactctcttac
acccagcgcggaacctccgccggaacggcctggctggaaagctatgaaattcgcctcaat
cccgttttgctgttggaaaacagtgaagcttttattgaagaagtggtaccgcacgaactg
gcacatttgctggtatggaaacatttcggccgcgtagcgccacatggcaaagagtggaag
tggatgatggaaaacgtgctgggtgttcccgcccgtcgtacgcatcagttcgaactgcaa
tccgtgcgtcgcaacaccttcccctaccgctgcaagtgccaggagcatcagcttaccgta
cgccgccataatcgcgtagttcgtggcgaggccgtctatcgctgtgttcactgcggtgaa
cagctggttgcgaaataa

DBGET integrated database retrieval system