KEGG   Escherichia coli K-12 MG1655: b2952Help
Entry
b2952             CDS       T00007                                 

Gene name
yggT
Definition
(RefSeq) putative inner membrane protein; compensates for loss in K+ uptake
  KO
K02221  
YggT family protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Secretion system [BR:eco02044]
 Type II secretion system
  Type IVa pilus homolog protein
   b2952 (yggT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3095820..3096386
Genome map
AA seq 188 aa AA seqDB search
MNTLTFLLSTVIELYTMVLLLRIWMQWAHCDFYNPFSQFVVKVTQPIIGPLRRVIPAMGP
IDSASLLVAYILSFIKAIVLFKVVTFLPIIWIAGLLILLKTIGLLIFWVLLVMAIMSWVS
QGRSPIEYVLIQLADPLLRPIRRLLPAMGGIDFSPMILVLLLYVINMGVAEVLQATGNML
LPGLWMAL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgttgactttcctgctttcaacggtcattgagctgtataccatggtgctgtta
ttacgcatctggatgcagtgggctcattgtgatttttacaaccccttctcacagtttgta
gtgaaggtaacgcagccaattatcgggccactgcgccgcgttattccggcaatggggcca
attgacagcgcctcgctgctggttgcctatattctcagttttatcaaagccatcgtgctg
tttaaagtggtgaccttcctgccaatcatctggattgccggtttactgattctgctgaaa
accatcggcctgctgattttctgggtcctgctggtgatggcgattatgagctgggtaagc
caggggcgtagcccgattgaatacgtgctgattcagctggccgatccgctgctgcgcccg
attcgccgcctgctaccggcaatgggtgggattgatttctcgccgatgatcctcgttctg
ctgctgtatgtcatcaatatgggtgtcgcagaagtattacaggcaaccggaaatatgctg
ctgccagggctgtggatggcgttatga

DBGET integrated database retrieval system