KEGG   Escherichia coli K-12 MG1655: b2960Help
Entry
b2960             CDS       T00007                                 

Gene name
trmI
Definition
(RefSeq) tRNA m(7)G46 methyltransferase, SAM-dependent (EC:2.1.1.33)
  KO
K03439  
tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     b2960 (trmI)
Transfer RNA biogenesis [BR:eco03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    b2960 (trmI)
 Prokaryotic Type
    b2960 (trmI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3102133..3102852)
Genome map
AA seq 239 aa AA seqDB search
MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQEHALENYWPVMGVEFSEDMLDFPALF
GREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCH
DAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATD
WEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgacgtcatttcaccggaatttgatgaaaacggccgcccactgcgccgtatc
cgtagttttgtgcgccgccaggggcgactgaccaaaggccaggaacatgcgctggaaaac
tactggccggtgatgggcgttgagttcagcgaagatatgctggatttccccgcgcttttt
ggccgtgaagcgccggtgacgcttgagattggttttggcatgggggcgtcgctggtggca
atggctaaagatcgccctgagcaggacttcctcggcattgaagtgcattcaccgggcgtt
ggtgcgtgcctggcttctgcgcatgaagaaggtttaagcaacctgcgcgtgatgtgtcac
gatgcggttgaagtgctgcataaaatgattcctgacaattcattgcgcatggtgcagctc
tttttccctgacccgtggcacaaagcgcgccataataaacgccgtatcgttcaggtgccg
tttgccgaactggtaaaaagcaaactgcagctggggggcgtattccatatggcgaccgac
tgggaaccttatgcggaacatatgcttgaagtgatgtcttctattgacggttataaaaac
ctgtcagagagcaatgattacgtaccgcgtccggcatcacgtccggtgacgaaatttgaa
caacgtggtcatcgtcttggtcacggagtatgggacttaatgttcgagagggtgaaataa

DBGET integrated database retrieval system