KEGG   Escherichia coli K-12 MG1655: b2961Help
Entry
b2961             CDS       T00007                                 

Gene name
mutY
Definition
adenine DNA glycosylase (EC:3.2.2.-)
Orthology
K03575  
A/G-specific adenine glycosylase [EC:3.2.2.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:eco03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3103013..3104065
Genome map
AA seq 350 aa AA seqDB search
MQASQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFP
TVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVGRS
TAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERF
NQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPKQTLPERTGYFLLLQH
EDEVLLAQRPPSGLWGGLYCFPQFADEESLRQWLAQRQIAADNLTQLTAFRHTFSHFHLD
IVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAPV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgtcgcaattttcagcccaggttctggactggtacgataaatacgggcgaaaa
actctgccctggcaaattgacaagacgccctacaaagtatggctctcagaagtgatgttg
caacaaactcaggttgcgaccgttatcccctattttgaacgctttatggcgcgcttcccg
acggtgaccgatctcgccaatgcgccgctcgacgaagttctccacttgtggaccgggctt
ggctattacgcccgcgcgcgcaatctgcataaagcggcacaacaagtggcgaccttacac
ggcggtaaattcccggaaacctttgaggaagttgcagcactgccgggcgtcgggcgttcc
accgcaggcgcgattctctcgctttctctgggtaagcactttccgattctcgacggtaac
gtcaaacgcgtgctggcgcgctgctatgctgtaagcggctggcctgggaaaaaagaggtc
gagaataaattatggagtttgagcgagcaggtgacgcccgcggttggcgtggaacggttt
aatcaggcgatgatggatttgggtgcgatgatttgtacgcgctcgaaaccgaaatgttcg
ctctgtccgctacaaaacggatgtattgccgccgccaacaatagctgggcgctttatccg
ggcaaaaaaccgaaacagacgctgccggagcgcaccggctactttttgctattacagcac
gaagatgaagtattgctggcgcagcgtccgccgagcggattgtggggcggtttatactgt
ttcccgcagtttgccgacgaagaaagtttgcggcagtggctggcgcaacggcagattgct
gccgataacctgacgcaactgaccgcgtttcggcataccttcagccatttccacttagat
attgtgcctatgtggcttcccgtgtcgtcattcaccggctgcatggatgaaggcaatgcg
ctctggtataacttagcgcaaccgccgtcagttggcctagcggctcccgtggagcgtttg
ttacagcagttacgcactggcgcgccggtttag

DBGET integrated database retrieval system