KEGG   Escherichia coli K-12 MG1655: b2966Help
Entry
b2966             CDS       T00007                                 

Gene name
yqgA
Definition
(RefSeq) DUF554 family putative inner membrane protein
  KO
K07150  
uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3109553..3110260
Genome map
AA seq 235 aa AA seqDB search
MVIGPFINASAVLLGGVLGALLSQRLPERIRVSMTSIFGLASLGIGILLVVKCANLPAMV
LATLLGALIGEICLLEKGVNTAVAKAQNLFRHSRKKPAHESFIQNYVAIIVLFCASGTGI
FGAMNEGMTGDPSILIAKSFLDFFTAMIFACSLGIAVSVISIPLLIIQLTLAWAAALILP
LTTPSMMADFSAVGGLLLLATGLRICGIKMFPVVNMLPALLLAMPLSAAWTAWFA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
gtggtcatcggcccttttatcaacgctagtgcagtcttactgggtggcgttctcggcgca
ctgctcagccaacgcttaccggaacgtatccgcgtctccatgacatcaatttttggtctg
gcatcgctggggattggtattttactggtggtgaaatgtgccaaccttccagcgatggtt
ttagctacgctacttggcgctctaattggcgaaatttgtttgctggagaaaggtgtcaat
acagcagtcgccaaagcacaaaatctgtttcgtcactcacgtaagaagccagcgcatgaa
tcttttattcagaattatgtcgcgattattgtcctgttttgcgccagcggcaccgggatc
ttcggggcgatgaacgaagggatgaccggcgatccgagtattttaatcgccaagtcattt
cttgatttctttacggcgatgatcttcgcctgctcgctgggtattgcggtatcggtgatt
agtatcccattactgatcatccagttaacgctggcgtgggctgccgcgctgattttaccg
ctgaccacaccgtcgatgatggcagacttcagcgccgtaggcggtttattgctgctggca
accggattacgcatctgtggcattaaaatgttcccggtggtcaacatgcttccagcactc
cttctggcaatgccgctttccgccgcctggaccgcctggtttgcctga

DBGET integrated database retrieval system