KEGG   Escherichia coli K-12 MG1655: b2983Help
Entry
b2983             CDS       T00007                                 

Gene name
yghQ
Definition
(RefSeq) putative inner membrane polysaccharide flippase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_3
Motif
Other DBs
NCBI-GeneID: 947716
NCBI-ProteinID: YP_026192
Pasteur: yghQ
RegulonDB: ECK120004109
ECOCYC: G7549
ASAP: ABE-0009786
UniProt: Q46841
Position
complement(3131341..3132408)
Genome map
AA seq 355 aa AA seqDB search
MAGFNIKHWFADGAFRTIIRNSAWLGSSNVVSALLGLLALSCAGKGMTPAMFGVLVIVQS
YAKSISDFIKFQTWQLVVQYGTPALTNNNPQQFRNVVSFSFSLDIVSGAVAIVGGIALLP
FLSHSLGLDDQSFWLAALYCTLIPSMASSTPTGILRAVDRFDLIAVQQATKPFLRAAGSV
VAWYFDFGFAGFVIAWYVSNLVGGTMYWWFAARELRRRNIHNAFKLNLFESARYIKGAWS
FVWSTNIAHSIWSARNSCSTVLVGIVLGPAAAGLFKIAMTFFDAAGTPAGLLGKSFYPEV
MRLDPRTTRPWLLGVKSGLLAGGIGILVALAVLIVGKPLISLVFGVKYLEAYDLI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggttttaacatcaaacattggtttgcagatggcgcgtttcgcaccattattcgc
aatagcgcctggttaggctccagtaatgtcgtgagcgccttgctgggtctgttggcgctc
tcgtgtgccggtaaagggatgacgcccgccatgtttggcgtactggtgattgtgcaatcg
tacgccaagtcgatcagcgattttattaagtttcagacatggcaactggtggttcagtac
ggaacaccagcattaaccaacaataatccgcagcaattccgcaatgtcgtctcattttcc
ttctcgctggatatcgtcagcggcgcggtggcgattgtcggtggcattgccttactgcca
ttcctttcccattcattaggtctggatgaccaaagtttttggctggcagcgctctattgc
acgctcattccttcaatggcttcctccacgccgaccggcattctgcgtgcggtagatcgc
ttcgatttaattgctgtacagcaggcgacgaaaccttttctgcgcgcagcggggagcgtc
gtagcctggtattttgactttggttttgcgggttttgttattgcctggtacgtgtcgaat
ctggttggcggcaccatgtactggtggtttgccgcgcgcgaattacgccgccgaaatatc
cataacgccttcaaattgaatctgtttgagtctgcccgatacattaaaggcgcgtggagt
tttgtctggtcaaccaacattgcccactccatctggtcggcgcgtaactcgtgcagcaca
gtgttggtggggatcgtgttaggacccgctgccgccgggttatttaaaatcgccatgaca
ttcttcgacgccgccggaacgccagcgggtttgctgggtaaaagtttttacccagaggtg
atgcgtttagatccgcgcaccaccagaccgtggttgttaggtgtgaagtccggtttactg
gcgggcggaatcggtattctggtggcgctcgcggtgttgatcgtcggcaagccgctcatt
tcgctggtgtttggcgttaagtatctcgaagcgtatgacctgatttag

DBGET integrated database retrieval system